DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgam5 and pgam-5

DIOPT Version :9

Sequence 1:NP_569951.1 Gene:Pgam5 / 31143 FlyBaseID:FBgn0023517 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_495593.2 Gene:pgam-5 / 174231 WormBaseID:WBGene00019941 Length:284 Species:Caenorhabditis elegans


Alignment Length:254 Identity:111/254 - (43%)
Similarity:156/254 - (61%) Gaps:13/254 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RDPQTVVQNSWTHSDKPVD---PWALWDTNWDCREPRALVRPLRNSQPEEENRYNAELEKAKAKK 85
            |......||   |..|..|   |...||.|||.|:|.:||...:..:.:||.:... :|:.||..
 Worm    33 RTASAFTQN---HGHKTFDEHFPRGEWDKNWDFRDPISLVDKGKWEKADEEGKKKL-IEEKKATA 93

  Fly    86 ARHIILVRHGEY-LDVGDSDDTHHLTERGRKQAEFTGKRLCELGIKWDKVVASTMVRAQETSDII 149
            .|:|.|:|||:| ||    .:...||..||:|||..||||....||:..:..||||||.||::||
 Worm    94 TRNIFLIRHGQYHLD----HEVKMLTPLGREQAELLGKRLANSDIKFTNMTMSTMVRATETANII 154

  Fly   150 LKQIDFEKEKVVNCAFLREGAPIPPQPPVGHWKPEASQFLRDGSRIEAGFRRYFHRAYPDQEKES 214
            ||.:..:..: .:..|:.||.|.||.|....|:|...:|..:.:|||:.:|:.||||.|.|:::|
 Worm   155 LKHLPDDLTR-TSSPFIEEGPPYPPVPDHKTWRPLDPEFYTEAARIESAYRKIFHRASPSQKEDS 218

  Fly   215 YTLIVGHGNVIRYFVCRALQFPAEGWLRININHASITWLTISPSGNVSIKYLGDSGFMP 273
            :.|||.|.||||||:|||||||.|||||:::.:.|:||:||.|.|:||::.:||.|.:|
 Worm   219 FELIVCHANVIRYFICRALQFPPEGWLRMSLGNCSLTWITIRPKGHVSVRSIGDIGHLP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgam5NP_569951.1 HP_PGM_like 88..265 CDD:132718 85/177 (48%)
pgam-5NP_495593.2 HP_PGM_like 96..270 CDD:132718 85/178 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157802
Domainoid 1 1.000 79 1.000 Domainoid score I5660
eggNOG 1 0.900 - - E1_KOG4609
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H14597
Inparanoid 1 1.050 206 1.000 Inparanoid score I2426
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58579
OrthoDB 1 1.010 - - D1112626at2759
OrthoFinder 1 1.000 - - FOG0006616
OrthoInspector 1 1.000 - - otm14764
orthoMCL 1 0.900 - - OOG6_104882
Panther 1 1.100 - - LDO PTHR20935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2720
SonicParanoid 1 1.000 - - X4856
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.