DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex5 and ttc37

DIOPT Version :9

Sequence 1:NP_726771.1 Gene:Pex5 / 31141 FlyBaseID:FBgn0023516 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001121453.1 Gene:ttc37 / 100158547 XenbaseID:XB-GENE-5929177 Length:1562 Species:Xenopus tropicalis


Alignment Length:302 Identity:64/302 - (21%)
Similarity:109/302 - (36%) Gaps:60/302 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 NDNM-DAYKEYEFAEGNPMSDVENPFE----KGKEYLSKG--DIPS------------------- 324
            :||. :|.|..|     .:|:.:|..|    ||..||.||  |:.|                   
 Frog   366 SDNAEEALKALE-----QISNADNDPEICAIKGHAYLKKGSTDVASKISEELRLSHEHLADGHFL 425

  Fly   325 -------------AVLCFEVAAKKQPERAEVWQLLGTS----QTENEMD-PQAIAALKRAYDLQP 371
                         |.|..:.|.::.||.|.....||.:    ..|...| .:|:....:|..:.|
 Frog   426 EGLIQYTQKNYSAAELSLQYALERNPENAVYQYYLGLTYWFMSKETRRDKTKAVTQFLKAAKMDP 490

  Fly   372 DNQQVLMALAACYTNEGLQNNAVRMLCNWLTVHPKYQHLVAAHPELQAEGTSLASSLIGPSKLRD 436
            ...:....|...|:......:..|      ..:.|...:..:..|..|....|:..|    :..|
 Frog   491 FMSKAFYYLGHYYSQVVGDKSRAR------GCYKKAFEIDGSDGEAGAAAVDLSMEL----EDMD 545

  Fly   437 LQQIYLEAVRQHPSEVDAE-VQDALGVLYNLSGEFDKAVDCYQSALQVDPQNAKTWNRLGASLAN 500
            :....|.:|.:..:...|: .....|:.|...|:..|:|....:||:.||:::..|..||.:..:
 Frog   546 VALAILTSVTERANAGSAKWAWLRRGLFYLRVGQHSKSVSDLHAALRADPKDSNCWECLGEAYLS 610

  Fly   501 GSRSVEAVEAYQQALQLQPGFIRVRYNVGVCCMNLKAYKEAV 542
            ......|::::.:|.:|.|..|...|.:......|..||||:
 Frog   611 RGGYTTALKSFMKASELNPDSIYSVYKIASIKQILGTYKEAI 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex5NP_726771.1 TPR_11 310..371 CDD:290150 21/103 (20%)
TPR repeat 310..334 CDD:276809 12/61 (20%)
TPR repeat 339..369 CDD:276809 7/34 (21%)
TPR repeat 374..397 CDD:276809 3/22 (14%)
TPR_11 453..519 CDD:290150 16/66 (24%)
TPR repeat 454..482 CDD:276809 7/28 (25%)
TPR_1 460..487 CDD:278916 9/26 (35%)
TPR repeat 487..517 CDD:276809 5/29 (17%)
TPR_1 488..521 CDD:278916 7/32 (22%)
TPR_16 493..549 CDD:290168 13/50 (26%)
TPR repeat 522..549 CDD:276809 7/21 (33%)
ttc37NP_001121453.1 TPR_16 10..72 CDD:290168
TPR repeat 39..69 CDD:276809
TPR_11 42..108 CDD:290150
TPR repeat 74..105 CDD:276809
TPR repeat 116..144 CDD:276809
TPR repeat 271..301 CDD:276809
TPR repeat 306..334 CDD:276809
TPR repeat 386..414 CDD:276809 9/27 (33%)
TPR repeat 420..448 CDD:276809 3/27 (11%)
TPR 433..716 CDD:223533 48/230 (21%)
TPR repeat 453..488 CDD:276809 7/34 (21%)
TPR repeat 493..522 CDD:276809 4/34 (12%)
TPR repeat 566..592 CDD:276809 6/25 (24%)
TPR repeat 597..627 CDD:276809 5/29 (17%)
BamD 605..>712 CDD:276939 12/48 (25%)
TPR repeat 632..660 CDD:276809 7/21 (33%)
TPR repeat 662..710 CDD:276939
TPR repeat 666..701 CDD:276809
TPR repeat 776..817 CDD:276809
TPR repeat 826..853 CDD:276809
TPR repeat 858..888 CDD:276809
type_IV_pilW 958..1148 CDD:131573
TPR repeat 980..1012 CDD:276809
TPR repeat 1020..1043 CDD:276809
TPR repeat 1048..1078 CDD:276809
TPR repeat 1086..1112 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.