Sequence 1: | NP_726771.1 | Gene: | Pex5 / 31141 | FlyBaseID: | FBgn0023516 | Length: | 614 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001121453.1 | Gene: | ttc37 / 100158547 | XenbaseID: | XB-GENE-5929177 | Length: | 1562 | Species: | Xenopus tropicalis |
Alignment Length: | 302 | Identity: | 64/302 - (21%) |
---|---|---|---|
Similarity: | 109/302 - (36%) | Gaps: | 60/302 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 286 NDNM-DAYKEYEFAEGNPMSDVENPFE----KGKEYLSKG--DIPS------------------- 324
Fly 325 -------------AVLCFEVAAKKQPERAEVWQLLGTS----QTENEMD-PQAIAALKRAYDLQP 371
Fly 372 DNQQVLMALAACYTNEGLQNNAVRMLCNWLTVHPKYQHLVAAHPELQAEGTSLASSLIGPSKLRD 436
Fly 437 LQQIYLEAVRQHPSEVDAE-VQDALGVLYNLSGEFDKAVDCYQSALQVDPQNAKTWNRLGASLAN 500
Fly 501 GSRSVEAVEAYQQALQLQPGFIRVRYNVGVCCMNLKAYKEAV 542 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pex5 | NP_726771.1 | TPR_11 | 310..371 | CDD:290150 | 21/103 (20%) |
TPR repeat | 310..334 | CDD:276809 | 12/61 (20%) | ||
TPR repeat | 339..369 | CDD:276809 | 7/34 (21%) | ||
TPR repeat | 374..397 | CDD:276809 | 3/22 (14%) | ||
TPR_11 | 453..519 | CDD:290150 | 16/66 (24%) | ||
TPR repeat | 454..482 | CDD:276809 | 7/28 (25%) | ||
TPR_1 | 460..487 | CDD:278916 | 9/26 (35%) | ||
TPR repeat | 487..517 | CDD:276809 | 5/29 (17%) | ||
TPR_1 | 488..521 | CDD:278916 | 7/32 (22%) | ||
TPR_16 | 493..549 | CDD:290168 | 13/50 (26%) | ||
TPR repeat | 522..549 | CDD:276809 | 7/21 (33%) | ||
ttc37 | NP_001121453.1 | TPR_16 | 10..72 | CDD:290168 | |
TPR repeat | 39..69 | CDD:276809 | |||
TPR_11 | 42..108 | CDD:290150 | |||
TPR repeat | 74..105 | CDD:276809 | |||
TPR repeat | 116..144 | CDD:276809 | |||
TPR repeat | 271..301 | CDD:276809 | |||
TPR repeat | 306..334 | CDD:276809 | |||
TPR repeat | 386..414 | CDD:276809 | 9/27 (33%) | ||
TPR repeat | 420..448 | CDD:276809 | 3/27 (11%) | ||
TPR | 433..716 | CDD:223533 | 48/230 (21%) | ||
TPR repeat | 453..488 | CDD:276809 | 7/34 (21%) | ||
TPR repeat | 493..522 | CDD:276809 | 4/34 (12%) | ||
TPR repeat | 566..592 | CDD:276809 | 6/25 (24%) | ||
TPR repeat | 597..627 | CDD:276809 | 5/29 (17%) | ||
BamD | 605..>712 | CDD:276939 | 12/48 (25%) | ||
TPR repeat | 632..660 | CDD:276809 | 7/21 (33%) | ||
TPR repeat | 662..710 | CDD:276939 | |||
TPR repeat | 666..701 | CDD:276809 | |||
TPR repeat | 776..817 | CDD:276809 | |||
TPR repeat | 826..853 | CDD:276809 | |||
TPR repeat | 858..888 | CDD:276809 | |||
type_IV_pilW | 958..1148 | CDD:131573 | |||
TPR repeat | 980..1012 | CDD:276809 | |||
TPR repeat | 1020..1043 | CDD:276809 | |||
TPR repeat | 1048..1078 | CDD:276809 | |||
TPR repeat | 1086..1112 | CDD:276809 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |