DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED18 and AT2G22370

DIOPT Version :9

Sequence 1:NP_569948.3 Gene:MED18 / 31140 FlyBaseID:FBgn0026873 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_565534.1 Gene:AT2G22370 / 816769 AraportID:AT2G22370 Length:219 Species:Arabidopsis thaliana


Alignment Length:215 Identity:56/215 - (26%)
Similarity:84/215 - (39%) Gaps:53/215 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NLEYLLQGSILDSAVEHLMHRLKGLCDNVDTSPEPFHDLEVCMSLRQ-PNANQPLLLRVRRALGR 85
            ::|.::||.|....||.|...|:|||   ....|.....|:|  ||. ||.. .:...||.....
plant     2 SMECVVQGIIETQHVEALEILLQGLC---GVQRERLRVHELC--LRSGPNLG-VVSSEVRLLCDL 60

  Fly    86 DAP----------FQMRYLGNPEVDLRRPTLVRSCMDCACTNGILEFLTEMGFRLEFEYIAKGYM 140
            |.|          ..||..|..::.:    |||:.::...:...|.....:|::|:.|.:..|:.
plant    61 DQPEPTWTVKHVGGAMRGAGADQISV----LVRNMIESKVSKNALRMFYALGYKLDHELLKVGFA 121

  Fly   141 F---RKGRMKITVSKL------------IKIVPGKQQDMANEPISQSYIVELSVVAPTGQENVGE 190
            |   |...:.::||.:            :.:.||.|            ||:  |.||...||..|
plant   122 FHFQRTAHISVSVSSVNKMPKVHAIDEAVPVTPGMQ------------IVD--VTAPATSENYSE 172

  Fly   191 ---EMRVFAEQLKPLVQLEK 207
               .:..|.|.|.|||.|.|
plant   173 VAAAVSSFCEFLAPLVHLSK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED18NP_569948.3 Med18 24..213 CDD:286687 56/213 (26%)
AT2G22370NP_565534.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3264
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 40 1.000 Inparanoid score I2700
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140930at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106422
Panther 1 1.100 - - LDO PTHR13321
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.