DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED18 and Med18

DIOPT Version :9

Sequence 1:NP_569948.3 Gene:MED18 / 31140 FlyBaseID:FBgn0026873 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001108509.1 Gene:Med18 / 682988 RGDID:1592757 Length:208 Species:Rattus norvegicus


Alignment Length:194 Identity:106/194 - (54%)
Similarity:142/194 - (73%) Gaps:8/194 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LEYLLQGSILDSAVEHLMHRLKGLCDNVDTSPEPFHDLEVCMSLRQPNANQPLLLRVRRALGR-D 86
            :|||||||:||.::|.|:|||:|||||::  ||.|.|.|:...|:...|: |.:||.||::.| .
  Rat    19 MEYLLQGSVLDHSLESLIHRLRGLCDNME--PETFLDHEMVFLLKGQQAS-PFVLRARRSMDRAG 80

  Fly    87 APFQMRYLGNPEV-DLRRPTLVRSCMDCACTNGILEFLTEMGFRLEFEYIAKGYMFRKGRMKITV 150
            ||:.:||||.||: |..|..|||:|:|.|.:..:.:||.|||||::.|::|||::||||.|||.|
  Rat    81 APWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVAKGHLFRKGIMKIVV 145

  Fly   151 SKLIKI-VPGKQQDMANEPISQSYIVELSVVAPTGQENVGEEMRVFAEQLKPLVQLEKIDYKRL 213
            .|:.:| |||...  :.|.:|.||:||||||||.||:.|.::||.|||||||||.|||||.|||
  Rat   146 YKIFRILVPGNTD--STEALSLSYLVELSVVAPAGQDMVSDDMRNFAEQLKPLVHLEKIDPKRL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED18NP_569948.3 Med18 24..213 CDD:286687 104/191 (54%)
Med18NP_001108509.1 Med18 19..207 CDD:401539 104/192 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I3232
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9756
Inparanoid 1 1.050 193 1.000 Inparanoid score I3771
OMA 1 1.010 - - QHG48991
OrthoDB 1 1.010 - - D1140930at2759
OrthoFinder 1 1.000 - - FOG0007504
OrthoInspector 1 1.000 - - oto98808
orthoMCL 1 0.900 - - OOG6_106422
Panther 1 1.100 - - LDO PTHR13321
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6389
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.