DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED18 and med18

DIOPT Version :9

Sequence 1:NP_569948.3 Gene:MED18 / 31140 FlyBaseID:FBgn0026873 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001017086.1 Gene:med18 / 549840 XenbaseID:XB-GENE-1002158 Length:208 Species:Xenopus tropicalis


Alignment Length:193 Identity:105/193 - (54%)
Similarity:141/193 - (73%) Gaps:6/193 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LEYLLQGSILDSAVEHLMHRLKGLCDNVDTSPEPFHDLEVCMSLRQPNANQPLLLRVRRALGR-D 86
            :||||||||||..:|.|:|||:|||||::  ||.|.|.|....|:...|: |.:||.||.|.| .
 Frog    19 MEYLLQGSILDQGLESLLHRLRGLCDNME--PETFADHESVYLLKGQQAS-PFVLRARRPLDRPG 80

  Fly    87 APFQMRYLGNPEV-DLRRPTLVRSCMDCACTNGILEFLTEMGFRLEFEYIAKGYMFRKGRMKITV 150
            ||:.:||||.||. |..|.||||:|:|.|.::.:.|||.|||||::.|::|:|::||||.||:.|
 Frog    81 APWHLRYLGQPEAGDRSRHTLVRNCVDIATSDVLPEFLQEMGFRMDHEFVARGHLFRKGVMKVAV 145

  Fly   151 SKLIKIVPGKQQDMANEPISQSYIVELSVVAPTGQENVGEEMRVFAEQLKPLVQLEKIDYKRL 213
            .|:.:::.....:.| ||:|.||:||||.|||.||:|:.:|:|.|||||:|||||||||.|||
 Frog   146 YKVFRVLVAGAAEGA-EPLSLSYLVELSAVAPAGQDNIADEVRGFAEQLRPLVQLEKIDPKRL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED18NP_569948.3 Med18 24..213 CDD:286687 103/190 (54%)
med18NP_001017086.1 Med18 19..207 CDD:370594 103/191 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 137 1.000 Domainoid score I4872
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9756
Inparanoid 1 1.050 193 1.000 Inparanoid score I3733
OMA 1 1.010 - - QHG48991
OrthoDB 1 1.010 - - D1140930at2759
OrthoFinder 1 1.000 - - FOG0007504
OrthoInspector 1 1.000 - - oto105502
Panther 1 1.100 - - LDO PTHR13321
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6162
SonicParanoid 1 1.000 - - X6389
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.