DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED18 and med18

DIOPT Version :9

Sequence 1:NP_569948.3 Gene:MED18 / 31140 FlyBaseID:FBgn0026873 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_956629.1 Gene:med18 / 393306 ZFINID:ZDB-GENE-040426-1276 Length:208 Species:Danio rerio


Alignment Length:194 Identity:107/194 - (55%)
Similarity:141/194 - (72%) Gaps:8/194 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LEYLLQGSILDSAVEHLMHRLKGLCDNVDTSPEPFHDLEVCMSLRQPNANQPLLLRVRRA-LGRD 86
            :|||||||:||.::|.|:|||:|||||::  ||.|.|.|:...|:....| |.:||.||: |...
Zfish    19 MEYLLQGSVLDQSLESLLHRLRGLCDNME--PESFADHELVYLLKGQQGN-PFILRARRSLLDPS 80

  Fly    87 APFQMRYLGNPEV-DLRRPTLVRSCMDCACTNGILEFLTEMGFRLEFEYIAKGYMFRKGRMKITV 150
            .|:.:||||.||| |..|..|||:|:|.|.::.:.:||.|||||::.|::|||.:||||.||:.|
Zfish    81 VPWHLRYLGQPEVGDKSRHALVRNCVDVAASHSLPDFLNEMGFRMDHEFVAKGQVFRKGVMKVVV 145

  Fly   151 SKLIKI-VPGKQQDMANEPISQSYIVELSVVAPTGQENVGEEMRVFAEQLKPLVQLEKIDYKRL 213
            |||.:: |||...:  .||:|.||:|||||:||.||:.|.|:||.|||||||||.|||||.|||
Zfish   146 SKLSRVLVPGNTDN--TEPLSLSYLVELSVLAPAGQDTVSEDMRSFAEQLKPLVHLEKIDPKRL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED18NP_569948.3 Med18 24..213 CDD:286687 105/191 (55%)
med18NP_956629.1 Med18 19..207 CDD:286687 105/192 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595270
Domainoid 1 1.000 140 1.000 Domainoid score I4731
eggNOG 1 0.900 - - E1_KOG3264
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9756
Inparanoid 1 1.050 196 1.000 Inparanoid score I3806
OMA 1 1.010 - - QHG48991
OrthoDB 1 1.010 - - D1140930at2759
OrthoFinder 1 1.000 - - FOG0007504
OrthoInspector 1 1.000 - - oto38762
orthoMCL 1 0.900 - - OOG6_106422
Panther 1 1.100 - - LDO PTHR13321
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6162
SonicParanoid 1 1.000 - - X6389
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.