DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED18 and sep11

DIOPT Version :9

Sequence 1:NP_569948.3 Gene:MED18 / 31140 FlyBaseID:FBgn0026873 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_593364.1 Gene:sep11 / 2541925 PomBaseID:SPAC5D6.05 Length:207 Species:Schizosaccharomyces pombe


Alignment Length:129 Identity:28/129 - (21%)
Similarity:53/129 - (41%) Gaps:16/129 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LMHRLKGLCDNVDTSPEPFHDLEVCMSLRQPNANQPLLLRVRRALGRDAPFQMRYLGNPEVDLRR 103
            :::|.|.:..|:...|:.:  |.:|.::...:...       ....::..:.|...||.|.....
pombe    37 VVYRPKDVPPNLPRQPDSW--LRLCSNIESHDETD-------TEWSKNTQWSMYLEGNSEPKRED 92

  Fly   104 PTLVRSCMDCACTNG-ILEFLTEMGFRLEFEYIAKG--YMFRKGRMKITVSKLIKIVPGKQQDM 164
            ...:|.......||| :.||:.:||:....|||.:|  |.|    ...||.....::|.:|:.:
pombe    93 KCGIRPVNRAKLTNGSVTEFVEKMGYEFSHEYIIQGLEYFF----FDTTVRIYQTLIPSQQRSI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED18NP_569948.3 Med18 24..213 CDD:286687 28/129 (22%)
sep11NP_593364.1 Med18 2..203 CDD:312963 28/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13321
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.