DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14812 and Lamtor5

DIOPT Version :9

Sequence 1:NP_001259144.1 Gene:CG14812 / 31137 FlyBaseID:FBgn0026090 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_001099932.1 Gene:Lamtor5 / 295357 RGDID:1305005 Length:156 Species:Rattus norvegicus


Alignment Length:88 Identity:30/88 - (34%)
Similarity:44/88 - (50%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQQLEKVLAEIAARQDTVGALLANRQGLCLGTKGDIDPNVSGIGMAISEQVAKLELNATAPATI 65
            ||..||:.|.:.......||.|..:.|||.||.:|.:....:|:...:::|.|||..:.|....:
  Rat    66 MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVV 130

  Fly    66 CLYSGNKRCVIQKDGEITGVIFK 88
            ||.|.|...:|||...||..:.|
  Rat   131 CLESDNGNVMIQKHDGITVAVHK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14812NP_001259144.1 LAMTOR5 1..88 CDD:293277 29/86 (34%)
Lamtor5NP_001099932.1 LAMTOR5 66..153 CDD:293277 29/86 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337501
Domainoid 1 1.000 52 1.000 Domainoid score I11228
eggNOG 1 0.900 - - E1_2DG3F
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007482
OrthoInspector 1 1.000 - - oto96585
orthoMCL 1 0.900 - - OOG6_106928
Panther 1 1.100 - - LDO PTHR13342
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.750

Return to query results.
Submit another query.