DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14812 and lamtor5

DIOPT Version :9

Sequence 1:NP_001259144.1 Gene:CG14812 / 31137 FlyBaseID:FBgn0026090 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_001315002.1 Gene:lamtor5 / 100333504 ZFINID:ZDB-GENE-110411-193 Length:91 Species:Danio rerio


Alignment Length:88 Identity:27/88 - (30%)
Similarity:43/88 - (48%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQQLEKVLAEIAARQDTVGALLANRQGLCLGTKGDIDPNVSGIGMAISEQVAKLELNATAPATI 65
            ||..||:.|.:.......||.|..:.||..||.:|.:.....|:...:::|.|.|..:||...|:
Zfish     1 MEGALEQHLDDTMKNPAIVGVLCTDAQGHNLGCRGSLSDEHGGVVSVLAKQAASLTKDATDCPTV 65

  Fly    66 CLYSGNKRCVIQKDGEITGVIFK 88
            ||.|.....::::.|.||..:.|
Zfish    66 CLESDCGNILVRRHGTITLAVHK 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14812NP_001259144.1 LAMTOR5 1..88 CDD:293277 26/86 (30%)
lamtor5NP_001315002.1 LAMTOR5 1..88 CDD:293277 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576678
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DG3F
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1582960at2759
OrthoFinder 1 1.000 - - FOG0007482
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106928
Panther 1 1.100 - - LDO PTHR13342
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5018
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.