DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and REX4

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_014561.1 Gene:REX4 / 854075 SGDID:S000005440 Length:289 Species:Saccharomyces cerevisiae


Alignment Length:167 Identity:56/167 - (33%)
Similarity:87/167 - (52%) Gaps:35/167 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   687 ALDCEMSYTGRGLD-----VTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSGAKS 746
            |:|||  :.|.|.:     :.::|:|...|.:|.:.||:|...::::.|..||| :.:....|.:
Yeast   123 AMDCE--FVGVGPEGKESALARISIVNYFGHVVLDEFVKPREKVVEWRTWVSGI-KPEHMKNAIT 184

  Fly   747 LAEVQR---DLLQLITADTILIGHGLENDLRALRLVH--NTLIDTSISFPHCNGFPYRR------ 800
            ..|.|:   |:|:    ..||:||.|::||.||.|.|  :.|.|||      ...|:|:      
Yeast   185 FKEAQKKTADILE----GRILVGHALKHDLEALMLSHPKSLLRDTS------RHLPFRKLYAKGK 239

  Fly   801 --ALRHLTKVHLKRDIQAGDGTTGHSSFEDSRACMEL 835
              :|:.||:..||..||.|:    |||.||:||.|.|
Yeast   240 TPSLKKLTREVLKISIQEGE----HSSVEDARATMLL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916 56/167 (34%)
REX1_like 686..837 CDD:99848 56/167 (34%)
REX4NP_014561.1 REX4_like 122..274 CDD:99847 56/167 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.