DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and RNH70

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_011792.1 Gene:RNH70 / 853193 SGDID:S000003508 Length:553 Species:Saccharomyces cerevisiae


Alignment Length:171 Identity:76/171 - (44%)
Similarity:116/171 - (67%) Gaps:13/171 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   669 DFVRT---EHRGSGEDEPAVYALDCEMSYTGRGLDVTKVSLVALNGQLVYEHFVRPVCDIIDYNT 730
            |:|:|   .|.||     .::||||||..:.:||.:|::|||..:.:::||..|:|...|:||.|
Yeast   211 DWVQTVDFTHGGS-----HIFALDCEMCLSEQGLVLTRISLVNFDNEVIYEELVKPDVPIVDYLT 270

  Fly   731 QYSGITETDLCSGA-KSLAEVQRDLLQLITADTILIGHGLENDLRALRLVHNTLIDTSISFPHCN 794
            :||||||..|..|| |:|.|||:|||::|:...|||||.|:|||:.::|.|..::||:|.:.|..
Yeast   271 RYSGITEEKLTVGAKKTLREVQKDLLKIISRSDILIGHSLQNDLKVMKLKHPLVVDTAIIYHHKA 335

  Fly   795 GFPYRRALRHLTKVHLKRDIQAGDGTTGHSSFEDSRACMEL 835
            |.|::.:|::|::..|.:.||.|:    |.|.||:|||:||
Yeast   336 GDPFKPSLKYLSETFLNKSIQNGE----HDSVEDARACLEL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916 73/162 (45%)
REX1_like 686..837 CDD:99848 70/151 (46%)
RNH70NP_011792.1 REX1_like 226..374 CDD:99848 70/151 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002085
OrthoInspector 1 1.000 - - otm46628
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12801
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2254
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.900

Return to query results.
Submit another query.