DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and AT5G25800

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_001331646.1 Gene:AT5G25800 / 832649 AraportID:AT5G25800 Length:569 Species:Arabidopsis thaliana


Alignment Length:187 Identity:76/187 - (40%)
Similarity:113/187 - (60%) Gaps:9/187 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   664 NGPYYDFVRTE-----HRGSGEDEPAVYALDCEMSYTGRGLDVTKVSLVALNGQLVYEHFVRPVC 723
            ||  |.|.:.|     ...||...|.:.||||||..|..||::|:|:||.:.||::.:..|.|..
plant   193 NG--YTFEKLELTPTLPAPSGSCPPEIVALDCEMCITKEGLELTRVTLVDIQGQVLLDKLVMPTN 255

  Fly   724 DIIDYNTQYSGITETDLCSGAKSLAEVQRDLLQLITADTILIGHGLENDLRALRLVHNTLIDTSI 788
            .|.||||:|||||...:.....:|.::|.:.|:|:..:|||:||.|||||.:|::.||.:|||::
plant   256 PITDYNTRYSGITAVMMEGVTTTLKDIQEEFLKLVFKETILVGHSLENDLLSLKISHNLVIDTAV 320

  Fly   789 SFPHCNGFPYRRALRHLTKVHLKRDIQAGDGTTGHSSFEDSRACMELMLWRVNRELD 845
            .:.|.:|..|:..||.|.|..|.|:||  :..:||.|.||::|.|:|.|.::....|
plant   321 LYKHPHGRSYKTKLRILAKKFLAREIQ--ESESGHDSAEDAKAAMDLALLKIKHGPD 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916 69/161 (43%)
REX1_like 686..837 CDD:99848 66/150 (44%)
AT5G25800NP_001331646.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774159at2759
OrthoFinder 1 1.000 - - FOG0002085
OrthoInspector 1 1.000 - - otm2496
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12801
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.