DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and SDN2

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_196173.1 Gene:SDN2 / 830437 AraportID:AT5G05540 Length:466 Species:Arabidopsis thaliana


Alignment Length:182 Identity:63/182 - (34%)
Similarity:100/182 - (54%) Gaps:19/182 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   669 DFVRTEHRGSGED--EPA---VYALDCEMSYTGRGLD-VTKVSLVALNGQLVYEHFVRPVCDIID 727
            |:|||   |.|:.  ||.   :.|:||||.....|.: |.:|:.|..:.:::.:.||:|...::|
plant   124 DWVRT---GLGKKKMEPTKIEMIAIDCEMVLCEDGSEAVVRVAAVDRDLKVILDEFVKPNQPVVD 185

  Fly   728 YNTQYSGITETDLCSGAKSLAEVQRDLLQLITADTILIGHGLENDLRALRLVHNTLIDTSISFPH 792
            |.|..:|:|..||.....|:.::|..||..|:.||||:|..|.:||:.|::.|..:||||:.|.:
plant   186 YRTFITGLTAQDLEKATISVVDIQEKLLMFISEDTILVGQSLNHDLKVLKVDHARVIDTSLVFKY 250

  Fly   793 CNGFPYRRALR-------HLTKVHLKRDIQAGDGTTGHSSFEDSRACMELML 837
             |....||.||       :|.|..|..::|. :|.. |:...|:.|.|:|:|
plant   251 -NYDGTRRPLRLKRPSLNYLCKCILGYEVQK-EGVP-HNCVHDAEAAMKLVL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916 58/174 (33%)
REX1_like 686..837 CDD:99848 54/158 (34%)
SDN2NP_196173.1 REX1_like 143..299 CDD:99848 54/158 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12801
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.