DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and SDN1

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_190579.2 Gene:SDN1 / 824172 AraportID:AT3G50100 Length:409 Species:Arabidopsis thaliana


Alignment Length:163 Identity:52/163 - (31%)
Similarity:90/163 - (55%) Gaps:8/163 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   687 ALDCEMSYTGRGLD-VTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSGAKSLAEV 750
            |:||||.....|.: :.:|.:|..:.:::.:.||:|...::||.|..:|||..|:.:.:.|:.::
plant   142 AVDCEMVLCEDGTEGLVRVGVVDRDLKVILDEFVKPNKPVVDYRTDITGITAEDIENASLSVVDI 206

  Fly   751 QRDLLQLITADTILIGHGLENDLRALRLVHNTLIDTSISFPHCNGFPYRR-ALRHLTKVHLKRDI 814
            |..|...::..|||:||.|..||..|::.|..:|||::.|.:.|....|| :|.:|.|..|..::
plant   207 QETLQPFLSTGTILVGHSLNRDLEVLKIDHPKVIDTALVFKYPNTRKLRRPSLNNLCKSILGYEV 271

  Fly   815 QAGDGTTG--HSSFEDSRACMELMLWRVNRELD 845
            :    .||  |....|:.|.|:|.|..|.:.:|
plant   272 R----KTGVPHDCVHDASAAMKLALAVVEKRVD 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916 49/153 (32%)
REX1_like 686..837 CDD:99848 49/153 (32%)
SDN1NP_190579.2 REX1_like 141..292 CDD:99848 49/153 (32%)
RRM_SF 317..377 CDD:240668
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12801
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.