DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and AT3G50090

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_190578.1 Gene:AT3G50090 / 824171 AraportID:AT3G50090 Length:322 Species:Arabidopsis thaliana


Alignment Length:162 Identity:50/162 - (30%)
Similarity:78/162 - (48%) Gaps:19/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   687 ALDCEMSYTGRGLD-VTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSGAKSLAEV 750
            ||||||.....|.: |.:|..|..|.:::.:.||:|...::||.|..:|:|..|:.....||.::
plant    77 ALDCEMVLCEDGTEGVVRVGAVDRNLKVILDEFVKPHKPVVDYRTAITGVTAEDVQKATLSLVDI 141

  Fly   751 QRDLLQLITADTILIGHGLENDLRALRLVHNTLIDTSISFPHCNGFPYRR-ALRHLTKVHLKRDI 814
            |..|...::|..|||.|.:             :||||:.|.:.|....|| :|..|....|..::
plant   142 QEKLRPFLSAGAILIDHPI-------------VIDTSLVFKYPNSRKLRRPSLNTLCMSVLGYEV 193

  Fly   815 Q-AGDGTTGHSSFEDSRACMELMLWRVNRELD 845
            | ||   ..|....|:.|.|:|.|..:.:.:|
plant   194 QKAG---VSHHCVHDAAAAMKLALAVIKKRVD 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916 48/152 (32%)
REX1_like 686..837 CDD:99848 48/152 (32%)
AT3G50090NP_190578.1 DnaQ_like_exo 76..205 CDD:299142 44/143 (31%)
RRM_SF 236..300 CDD:240668
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.