DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and AT3G27970

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_189436.2 Gene:AT3G27970 / 822421 AraportID:AT3G27970 Length:357 Species:Arabidopsis thaliana


Alignment Length:310 Identity:72/310 - (23%)
Similarity:119/310 - (38%) Gaps:86/310 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   589 SLSKPCARCKRHF-----LVDELTGQYLTHEECQYHSG---------KYQRYYDGVSH------G 633
            :|...||.|.|.|     ||:        |.:..||||         |:.|.::.:..      .
plant    12 TLRNKCAACYRQFNKLEHLVE--------HMKISYHSGHEPTCGVCKKHCRSFESLREHLIGPLP 68

  Fly   634 RWTCCNEGEESSPGC--CL------GDRHVW----------SG-----SVVGVNGPYYDFVRTEH 675
            :..|.|  ..|..||  |:      ..|.:.          ||     :.:|:.    |....::
plant    69 KQECKN--IFSLRGCRFCMTILESPNSRRIHQERCQFSSVNSGLTTRMAALGLR----DKAMIDY 127

  Fly   676 RGSGEDEPAVYALDCEMSYTGRGLD-----VTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGI 735
            ..|  ..|.|.||.|:|  .|.|.|     ..:|.:...:..:::..:|:|...:..|..:.:||
plant   128 TSS--RSPRVVALSCKM--VGGGSDGSLDLCARVCITDESDNVIFHTYVKPSMAVTSYRYETTGI 188

  Fly   736 TETDLCSGAKSLAEVQRDLLQLIT-------------ADTILIGHGLENDLRALRLVH--NTLID 785
            ...:| ..|..|.:|||.:.:.:.             ...||:||||::||..|:|.:  :.:.|
plant   189 RPENL-RDAMPLKQVQRKIQEFLCNGEPMWKIRPRGGKARILVGHGLDHDLDRLQLEYPSSMIRD 252

  Fly   786 TSISFPHCNGFPYRRALRHLTKVHLKRDIQAGDGTTGHSSFEDSRACMEL 835
            |:...|.........:|::||:.:|..|:..|.    ...:||..|.|.|
plant   253 TAKYPPLMKTSKLSNSLKYLTQAYLGYDVHFGI----QDPYEDCVATMRL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622 11/52 (21%)
DnaQ 675..>837 CDD:223916 46/181 (25%)
REX1_like 686..837 CDD:99848 43/170 (25%)
AT3G27970NP_189436.2 C2H2 Zn finger 17..39 CDD:275371 8/29 (28%)
C2H2 Zn finger 46..63 CDD:275371 2/16 (13%)
REX4_like 136..300 CDD:99847 43/170 (25%)
DnaQ 159..328 CDD:223916 35/145 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.