DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and AEN

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_073604.3 Gene:AEN / 64782 HGNCID:25722 Length:325 Species:Homo sapiens


Alignment Length:202 Identity:62/202 - (30%)
Similarity:96/202 - (47%) Gaps:33/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   676 RGSGEDEPAVYALDCEMSYT---GRGLDVTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITE 737
            :.||.......|:||||..|   ||..::.:.|:|:.:|.::|:.::||...|.||.|::||||.
Human   101 KASGPLPSKCVAIDCEMVGTGPRGRVSELARCSIVSYHGNVLYDKYIRPEMPIADYRTRWSGITR 165

  Fly   738 TDLCSGAKSLAEVQRDLLQLITADTILIGHGLENDLRALRLVH-------NTLIDTSISFP--HC 793
            ..: ..|......|:::|:|:.. .:::||.|.||.:||:.||       .|.:...:|.|  |.
Human   166 QHM-RKAVPFQVAQKEILKLLKG-KVVVGHALHNDFQALKYVHPRSQTRDTTYVPNFLSEPGLHT 228

  Fly   794 NGFPYRRALRHLTKVHLKRDIQAGDGTTGHSSFEDSRACMEL--------------MLWRVNREL 844
            ..   |.:|:.|....|.:.||.|.  .||||.||:...|||              .||....:.
Human   229 RA---RVSLKDLALQLLHKKIQVGQ--HGHSSVEDATTAMELYRLVEVQWEQQEARSLWTCPEDR 288

  Fly   845 DPAWSWD 851
            :|..|.|
Human   289 EPDSSTD 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916 57/186 (31%)
REX1_like 686..837 CDD:99848 55/176 (31%)
AENNP_073604.3 Nucleolar localization signal 27..35
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..105 1/3 (33%)
DnaQ 106..314 CDD:223916 60/197 (30%)
DnaQ_like_exo 111..267 CDD:299142 55/162 (34%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:18264133 165..188 4/24 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..325 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154937
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.