Sequence 1: | NP_001188528.1 | Gene: | prage / 31136 | FlyBaseID: | FBgn0283741 | Length: | 852 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_073604.3 | Gene: | AEN / 64782 | HGNCID: | 25722 | Length: | 325 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 62/202 - (30%) |
---|---|---|---|
Similarity: | 96/202 - (47%) | Gaps: | 33/202 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 676 RGSGEDEPAVYALDCEMSYT---GRGLDVTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITE 737
Fly 738 TDLCSGAKSLAEVQRDLLQLITADTILIGHGLENDLRALRLVH-------NTLIDTSISFP--HC 793
Fly 794 NGFPYRRALRHLTKVHLKRDIQAGDGTTGHSSFEDSRACMEL--------------MLWRVNREL 844
Fly 845 DPAWSWD 851 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
prage | NP_001188528.1 | PH-like | <614..650 | CDD:302622 | |
DnaQ | 675..>837 | CDD:223916 | 57/186 (31%) | ||
REX1_like | 686..837 | CDD:99848 | 55/176 (31%) | ||
AEN | NP_073604.3 | Nucleolar localization signal | 27..35 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 85..105 | 1/3 (33%) | |||
DnaQ | 106..314 | CDD:223916 | 60/197 (30%) | ||
DnaQ_like_exo | 111..267 | CDD:299142 | 55/162 (34%) | ||
Nuclear localization signal. /evidence=ECO:0000269|PubMed:18264133 | 165..188 | 4/24 (17%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 281..325 | 5/15 (33%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154937 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0847 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |