DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and REXO4

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_065118.2 Gene:REXO4 / 57109 HGNCID:12820 Length:422 Species:Homo sapiens


Alignment Length:492 Identity:104/492 - (21%)
Similarity:179/492 - (36%) Gaps:138/492 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 ATTSATSSPTNSP----TSYPRANGNRKRIEAALEWR-REQELGRQNAN---FLVPPLRQYEQLE 457
            |:..|.|||...|    |...:.|..:||.     |: :.:|:.::.|:   .:|.|.:..|...
Human     8 ASKRAPSSPVAKPGPVKTLTRKKNKKKKRF-----WKSKAREVSKKPASGPGAVVRPPKAPEDFS 67

  Fly   458 FDDKTVVQQLRRHIIDNHLLRVYGFPVDSVVHEGAIEIFKCMPHMSFAAALAETAQAVTVINYHD 522
            .:.|.:.:.|                                        |.:.:||        
Human    68 QNWKALQEWL----------------------------------------LKQKSQA-------- 84

  Fly   523 GLTNRAEEEVANSTDSGNSSP---QSLDSESGGEWSGSECESSNSSSSSAGEAALGLELKYCHFV 584
                 .|:.:..|.......|   |....|:..:..|.|..:.....:|.|....|.::.  ...
Human    85 -----PEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMPAGKDQEASRGSVPSGSKMD--RRA 142

  Fly   585 PVERSLSKPCARCKRHFLVDELTGQYLTHEECQYHSGKYQRYYDGVSHGRWTCCNEGEESSPGCC 649
            ||.|:.:......|:.  ..|.|...:..|.            ..:.|.:    .:.:|::|...
Human   143 PVPRTKASGTEHNKKG--TKERTNGDIVPER------------GDIEHKK----RKAKEAAPAPP 189

  Fly   650 LGDRHVW-----SGSVVGVNGPYYDFVRTEHRGSGEDEPAV----------------YALDCEMS 693
            . :..:|     ...:....||  :..:...:..|:.|.:|                .||||||.
Human   190 T-EEDIWFDDVDPADIEAAIGP--EAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEMV 251

  Fly   694 YTG-RGLD--VTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSGAKSLAEVQRDLL 755
            ..| :|.:  ..:||:|...|:.||:.:|:|...:.||.|..|||...:|..| :.|..||:::.
Human   252 GVGPKGEESMAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQG-EELEVVQKEVA 315

  Fly   756 QLITADTILIGHGLENDLRALRLVH--NTLIDTSISFPH----CNGFPYRRALRHLTKVHLKRDI 814
            :::.. .||:||.|.|||:.|.|.|  ..:.||....|.    .:|.|   :||.|::..|...:
Human   316 EMLKG-RILVGHALHNDLKVLFLDHPKKKIRDTQKYKPFKSQVKSGRP---SLRLLSEKILGLQV 376

  Fly   815 QAGDGTTGHSSFEDSRACMELMLWRVNRELDPAWSWD 851
            |..:    |.|.:|::|.|.|.: .|.:|      |:
Human   377 QQAE----HCSIQDAQAAMRLYV-MVKKE------WE 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622 4/35 (11%)
DnaQ 675..>837 CDD:223916 57/186 (31%)
REX1_like 686..837 CDD:99848 54/159 (34%)
REXO4NP_065118.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..194 41/264 (16%)
REX4_like 244..394 CDD:99847 53/158 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.