DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and isg20l2

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_001096663.1 Gene:isg20l2 / 558447 ZFINID:ZDB-GENE-070928-8 Length:321 Species:Danio rerio


Alignment Length:164 Identity:65/164 - (39%)
Similarity:99/164 - (60%) Gaps:16/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 PAVY-ALDCEMSYTG-RGL--DVTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSG 743
            |..| ||||||..|| :|.  ::.:.|:|:.:|.:||:.:|:|:..:.||.|::|||...||.. 
Zfish   133 PIKYLALDCEMVGTGPKGAQSELARCSIVSYDGDVVYDKYVKPINPVTDYRTRWSGIRRQDLLH- 196

  Fly   744 AKSLAEVQRDLLQLITADTILIGHGLENDLRALRLVHNTL--IDTSISFPHCN---GFPYRR--A 801
            |......|::::::||. .:::||.:.||.:||:..|...  .||| ..|..|   |||.::  :
Zfish   197 ATPFYHAQKEIVKIITG-KVVVGHAIHNDFKALKYFHPAFQTRDTS-RIPLLNEKAGFPEKQCVS 259

  Fly   802 LRHLTKVHLKRDIQAGDGTTGHSSFEDSRACMEL 835
            |:.||:..||||||.  |..||||.||::|.|||
Zfish   260 LKKLTQAILKRDIQT--GYRGHSSVEDAKATMEL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916 65/164 (40%)
REX1_like 686..837 CDD:99848 64/161 (40%)
isg20l2NP_001096663.1 DnaQ 133..>293 CDD:223916 65/164 (40%)
ISG20 137..293 CDD:99852 63/160 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.