DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and Pan2

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_001382635.1 Gene:Pan2 / 408200 RGDID:1303301 Length:1207 Species:Rattus norvegicus


Alignment Length:191 Identity:52/191 - (27%)
Similarity:87/191 - (45%) Gaps:29/191 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   658 GSVVGVNGPYYDFVRTEHRGSGEDEPAVYALDCEMSYTGRGLDVTKVSLVALNGQ----LVYEHF 718
            |.:||::.   :||..     .|:|..:.:...:.:.....:.|.:::.|...|.    ...:.:
  Rat   977 GDLVGLDA---EFVTL-----NEEEAELRSDGTKSTIKPSQMSVARITCVRGQGPNEGIPFIDDY 1033

  Fly   719 VRPVCDIIDYNTQYSGITETDLCS--GAKSLAEVQRDLLQ---LITADTILIGHGLENDLRALRL 778
            :.....::||.||||||...||.:  .:|.|..::...|:   ||......:||||:.|.|.:.|
  Rat  1034 ISTQEQVVDYLTQYSGIKPGDLDAKISSKHLTTLKSTYLKLRFLIDIGVKFVGHGLQKDFRVINL 1098

  Fly   779 V--HNTLIDTSISFPHCNGFPYRR--ALRHLTKVHLKRDIQAGDGTTGHSSFEDSRACMEL 835
            :  .:.::||...| |   .|.:|  :||.|....|...||   |.| |.|.||:|..::|
  Rat  1099 MVPKDQVLDTVYLF-H---MPRKRMISLRFLAWYFLDLKIQ---GET-HDSIEDARTALQL 1151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916 47/174 (27%)
REX1_like 686..837 CDD:99848 45/163 (28%)
Pan2NP_001382635.1 WD 1. /evidence=ECO:0000255|HAMAP-Rule:MF_03182 153..193
WD 2. /evidence=ECO:0000255|HAMAP-Rule:MF_03182 195..231
WD 3. /evidence=ECO:0000255|HAMAP-Rule:MF_03182 244..280
WD 4. /evidence=ECO:0000255|HAMAP-Rule:MF_03182 328..367
Linker. /evidence=ECO:0000255|HAMAP-Rule:MF_03182 368..484
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.