DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and SPAC637.09

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_594627.2 Gene:SPAC637.09 / 2543505 PomBaseID:SPAC637.09 Length:631 Species:Schizosaccharomyces pombe


Alignment Length:166 Identity:63/166 - (37%)
Similarity:101/166 - (60%) Gaps:3/166 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 PAVYALDCEMSYTGRGLDVTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSGAKSL 747
            |.:.|:||||..|..||::.:|::|.:..:::|:.||:|...:.||.||||||||..|.:....|
pombe   274 PKILAIDCEMVRTENGLEIARVTIVDMKSEVIYDEFVKPESPVTDYVTQYSGITEEKLRNVTTVL 338

  Fly   748 AEVQRDLLQLITADTILIGHGLENDLRALRLVHNTLIDTSISFPHCNGFPYRRALRHLTKVHLKR 812
            ::||..|.:.:..:|:|:||.|.:||..|:..|..:|||:..:.|..|.|.:.:|:.|....|:|
pombe   339 SDVQSYLKKTVDNNTVLLGHSLNSDLNCLKFTHPHIIDTANIYNHTRGPPSKPSLKWLATKWLRR 403

  Fly   813 DIQAGDGTTGHSSFEDSRACMELMLWRVNRELDPAW 848
            :||.. |..||.|.||:.||::|:..:|..  .||:
pombe   404 EIQKA-GALGHDSAEDALACVDLLKLKVKN--GPAF 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916 60/153 (39%)
REX1_like 686..837 CDD:99848 59/150 (39%)
SPAC637.09NP_594627.2 DnaQ 272..532 CDD:223916 63/166 (38%)
REX1_like 277..427 CDD:99848 59/150 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12801
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2254
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.900

Return to query results.
Submit another query.