DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and Trex2

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_036037.1 Gene:Trex2 / 24102 MGIID:1346343 Length:236 Species:Mus musculus


Alignment Length:194 Identity:42/194 - (21%)
Similarity:64/194 - (32%) Gaps:75/194 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   691 EMSYTGRGLDVTKVSLVAL--------NGQLV--YEHFVR----PVCDI----IDYNTQYSGITE 737
            |..:|.:..::|.:|..:|        ||.:|  .:.|:.    |:|.:    .||:...     
Mouse    67 ERPFTAKASEITGLSSESLMHCGKAGFNGAVVRTLQGFLSRQEGPICLVAHNGFDYDFPL----- 126

  Fly   738 TDLCSGAKSLAEVQRDLLQLITADTILIGHGLENDLRALRLVHNTLIDTSISFPHCNGFPYRRAL 802
              ||:      |:||            :|..|..|        ...:||   .|...|..  ||.
Mouse   127 --LCT------ELQR------------LGAHLPQD--------TVCLDT---LPALRGLD--RAH 158

  Fly   803 RHLTKVH----------LKRDIQAGDGTTGHSSFEDSRACMELMLWRVNRELDPAW------SW 850
            .|.|:..          ..|..|| :.:..||:..|....:.:.|.|....|  ||      ||
Mouse   159 SHGTRAQGRKSYSLASLFHRYFQA-EPSAAHSAEGDVHTLLLIFLHRAPELL--AWADEQARSW 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916 35/173 (20%)
REX1_like 686..837 CDD:99848 35/173 (20%)
Trex2NP_036037.1 TREX1_2 10..204 CDD:99839 36/175 (21%)
Substrate binding. /evidence=ECO:0000250 16..17
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.