DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and Trex1

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_001012236.1 Gene:Trex1 / 22040 MGIID:1328317 Length:314 Species:Mus musculus


Alignment Length:230 Identity:45/230 - (19%)
Similarity:68/230 - (29%) Gaps:55/230 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PPYVAAIKRKIDPEQQQQRKQHRSNILGCNKSSSINCSSINGDNRHLQRQQGKMYYNSSSRPFWR 79
            ||.|....|.:|         ..|..:...|:.|...|.|.|.::.....||:..::.:.....|
Mouse    54 PPPVPRPPRVVD---------KLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLR 109

  Fly    80 KCRSAAP----------------------TNLMTTIPTNNDLCNTAAAATYDKMQSCNKNSSSRI 122
            ......|                      ..|.|..|.:...|..:.||    :::..:.||.  
Mouse   110 AFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAA----LKALEQASSP-- 168

  Fly   123 TTTNNNVTTTSNISGNSSNKRCPQKYTGNTLAVNSNMLAYQQQATAGGKNSTRKSRHNNNKQNHQ 187
                         |||.|.|    .|:..::.......|.....||.|...|..|......|...
Mouse   169 -------------SGNGSRK----SYSLGSIYTRLYWQAPTDSHTAEGDVLTLLSICQWKPQALL 216

  Fly   188 QQQQQQQQQFDHIHKRNGTAGGTG-SECSPAAPTS 221
            |...:..:.|..:....||...|| :...|.|.|:
Mouse   217 QWVDEHARPFSTVKPMYGTPATTGTTNLRPHAATA 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916
REX1_like 686..837 CDD:99848
Trex1NP_001012236.1 DnaQ 13..>204 CDD:223916 33/181 (18%)
TREX1_2 14..211 CDD:99839 35/188 (19%)
Substrate binding 20..21
Proline-rich region 54..63 3/8 (38%)
Necessary for endoplasmic reticulum localization 236..314 5/16 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..284 5/15 (33%)
Interaction with UBQLN1. /evidence=ECO:0000250 244..314 3/8 (38%)
Necessary for cytoplasmic retention 281..314
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.