DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and C05C8.5

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_504838.1 Gene:C05C8.5 / 179116 WormBaseID:WBGene00015462 Length:594 Species:Caenorhabditis elegans


Alignment Length:173 Identity:54/173 - (31%)
Similarity:100/173 - (57%) Gaps:12/173 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   685 VYALDCEMSYTG-RGLDVTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSG-AKSL 747
            ::::||||..|. ...::|::|:|......:.:..|:|...|.||.|::|||| .|:..| ..:|
 Worm   221 MFSVDCEMCETDVANRELTRISIVDEFENTILDTLVKPEGRITDYVTRWSGIT-PDMMEGVTTTL 284

  Fly   748 AEVQRDLLQLITADTILIGHGLENDLRALRLVHNTLIDTS--ISFPHCNGFPYRRALRHLTKVHL 810
            .:||:.:..|:..|.||:||.||:||:|:::.|...:|..  :::.:.| ..:|.:|::||::.|
 Worm   285 GDVQKAIQSLLPPDAILVGHSLEHDLQAMKMTHPFCLDVGHVLNYTNSN-TEFRNSLKNLTELFL 348

  Fly   811 KRDIQAGDGTTGHSSFEDSRACMELMLWRVNREL---DPAWSW 850
            ...||:   ..||.|:||:.|.|.|...::.:.|   :.::.|
 Worm   349 GAQIQS---EFGHCSYEDAWAAMRLAQLKLEKGLMFGNVSFGW 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916 52/155 (34%)
REX1_like 686..837 CDD:99848 52/154 (34%)
C05C8.5NP_504838.1 REX1_like 222..372 CDD:99848 52/154 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12801
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.