DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and Y56A3A.33

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_001366957.1 Gene:Y56A3A.33 / 176636 WormBaseID:WBGene00013244 Length:342 Species:Caenorhabditis elegans


Alignment Length:268 Identity:95/268 - (35%)
Similarity:152/268 - (56%) Gaps:44/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   592 KPCARCKRHFLVDELTGQYL------THEECQYHSGKYQRYYD---GVSHGRWTCCN-EGEESSP 646
            :.|:||.:.|        ||      ..::|.||   ::..:|   |..|  ..||: :...|:.
 Worm    92 RKCSRCSKGF--------YLNPDGTANAQKCVYH---HRAKWDPLTGKKH--LPCCSAKPGPSTK 143

  Fly   647 GCCLGDRHVWSGSVVGVNGPYYDFV-------RTEHRGSGEDEPAVYALDCEMSYTGRGLDVTKV 704
            ||.:.||||:|.|   .....::||       :.:||.:     .|:|||||:.:|..||:|.:|
 Worm   144 GCLVEDRHVFSQS---WEDTLWEFVVSPQAKGKDDHRSN-----KVFALDCELVHTLNGLEVARV 200

  Fly   705 SLVALNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSGAKSLAEVQRDLLQLITADTILIGHGL 769
            |||.:.|:::.:.|..||.::|.:|:.:||:||.|: ..|.||...:..|.|||.::|:|:||.|
 Worm   201 SLVDMKGKVLLDTFALPVFEVISFNSTFSGVTEKDM-ESAISLEACRLQLFQLINSETLLVGHSL 264

  Fly   770 ENDLRALRLVHNTLIDTSISF---PHCNGFPYRRALRHLTKVHLKRDIQAGDGTTGHSSFEDSRA 831
            |:||:||||||:.:|||::.|   .....:..:.:|::|.|.:|.:|:|:  ..:||||.|||..
 Worm   265 ESDLKALRLVHHNVIDTAVLFSIVDPSRSYILKLSLQNLAKKYLCKDVQS--EASGHSSIEDSHT 327

  Fly   832 CMELMLWR 839
            ||||:..|
 Worm   328 CMELLATR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622 11/39 (28%)
DnaQ 675..>837 CDD:223916 69/164 (42%)
REX1_like 686..837 CDD:99848 66/153 (43%)
Y56A3A.33NP_001366957.1 REX1_like 182..332 CDD:99848 65/152 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002085
OrthoInspector 1 1.000 - - mtm4760
orthoMCL 1 0.900 - - OOG6_103246
Panther 1 1.100 - - O PTHR12801
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2254
SonicParanoid 1 1.000 - - X1541
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.