DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and isg20

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:XP_003201484.2 Gene:isg20 / 100534720 ZFINID:ZDB-GENE-100422-17 Length:338 Species:Danio rerio


Alignment Length:296 Identity:70/296 - (23%)
Similarity:113/296 - (38%) Gaps:92/296 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   557 SECESSNSSSSSAGEAALGLELKYCHFVPVERSLSKPCARCKRHFLVDELTGQYLTHEECQYHSG 621
            :||..:.|:|....|.:..::.|            :|           .||...|..|..:..||
Zfish    70 TECIKNGSTSDFVSEESNNMQFK------------RP-----------RLTHHTLPGESWEVDSG 111

  Fly   622 KYQRYYDGVSHGRWTCCNEGEESSPGCCLGDRHVWSGSVVGVNGPYYDFVRTEHRGSGEDEPAVY 686
                              ...||||            ...|.:.|   .:|.:|       ..:.
Zfish   112 ------------------FSSESSP------------PTSGRSSP---CLRIDH-------SRIV 136

  Fly   687 ALDCEMSYTGRG---LDVTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSGAKSLA 748
            |:||||..||.|   .:|.:.|:|...|.:||:.::.|...:.||.|::|||....| ..|....
Zfish   137 AMDCEMVGTGPGGRRSEVARCSIVDYYGNVVYDSYILPQDPVTDYRTRWSGIRSHHL-RQAVPFE 200

  Fly   749 EVQRDLLQLITADTILIGHGLENDLRAL------RLVHNT--------LIDTSISFPHCNGFPYR 799
            ..|.::|:::.. .|::||.|.:||..|      .::.:|        |.|.:   .:||     
Zfish   201 HAQNEILKILKG-KIIVGHALYHDLNVLYISVQPHMIRDTCSCVLLRQLYDVN---QNCN----- 256

  Fly   800 RALRHLTKVHLKRDIQAGDGTTGHSSFEDSRACMEL 835
            .:|:.|.:..|.|.||.  ...||.|.||:.:.::|
Zfish   257 ISLKKLAQKLLNRTIQV--DRQGHCSVEDALSALDL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622 7/35 (20%)
DnaQ 675..>837 CDD:223916 50/178 (28%)
REX1_like 686..837 CDD:99848 49/167 (29%)
isg20XP_003201484.2 ISG20 136..292 CDD:99852 49/167 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.