DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and rexo4

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:XP_002665913.1 Gene:rexo4 / 100333127 ZFINID:ZDB-GENE-050411-124 Length:418 Species:Danio rerio


Alignment Length:174 Identity:57/174 - (32%)
Similarity:88/174 - (50%) Gaps:26/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   674 EHRGSGEDEPAVYALDCEM---SYTGRGLDVTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGI 735
            ||...|...  ..|:||||   .|.|....:.:||||...|:.:|:.:|:|...:.||.|..|||
Zfish   224 EHAFEGVTR--AVAMDCEMVGVGYKGEDSILARVSLVNHFGKCIYDKYVKPTEKVTDYRTAVSGI 286

  Fly   736 TETDLCSGAKSLAEVQRDLLQLITADTILIGHGLENDLRALRLVH--NTLIDTSISFPHCNGFPY 798
            ...|:.:| :.:..||:::.|::.. .||:||.:.|||:.|.|.|  ..:.||.      ...|:
Zfish   287 RPDDIKNG-EDIKTVQKEVAQILKG-RILVGHAIHNDLKILLLDHPKKMIRDTQ------RYKPF 343

  Fly   799 RR-------ALRHLTKVHLKRDIQAGDGTTGHSSFEDSRACMEL 835
            |:       |||:|.:..|...:|.|:    |||.:|::|.|.|
Zfish   344 RQKVKSSRPALRNLCRQILNVQVQQGE----HSSVQDAQATMRL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916 56/173 (32%)
REX1_like 686..837 CDD:99848 54/162 (33%)
rexo4XP_002665913.1 DnaQ 231..>384 CDD:223916 54/167 (32%)
REX4_like 234..385 CDD:99847 54/162 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.