DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prage and Trex1

DIOPT Version :9

Sequence 1:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_001020160.1 Gene:Trex1 / 100049583 RGDID:1311998 Length:316 Species:Rattus norvegicus


Alignment Length:268 Identity:47/268 - (17%)
Similarity:81/268 - (30%) Gaps:89/268 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 YGRQFVHSSCIEDKLLGHHNPGHRNSTSSDATSEDIDSSSELPNK-----SKGNSC-AGSIHASG 286
            |.:..:...|    ||..|.....||:.|:.....:.....:.:|     :.|..| :|:...:|
  Rat    26 YSQPKITELC----LLAVHRHALENSSMSEGQPPPVPKPPRVVDKLSLCIAPGKPCSSGASEITG 86

  Fly   287 GSKSRSKRHQKQSGQQT----------RNPD------HNGQR------------TGAATPCTGQK 323
            .:.:..:.|.:|.....          |.|.      |||.|            ....:|..|..
  Rat    87 LTTAGLEAHGRQRFNDNLATLLQVFLQRQPQPCCLVAHNGDRYDFPLLQAELASLSVISPLDGTF 151

  Fly   324 AKQGNA--KWRQQQPNPSSNNQQQ---------------------------------QMQQQMQQ 353
            .....|  |..:|..:||.:..::                                 |.:.|...
  Rat   152 CVDSIAALKTLEQASSPSEHGPRKSYSLGSIYTRLYGQAPTDSHTAEGDVLALLSICQWKPQALL 216

  Fly   354 QKRGRNKKPGKWSNNIIDNPNSNHGGSSQQKTCDSSSSSALSSPTSSATTSATSSPTNS------ 412
            |...::.:|       .......:|.::   |..::|....::.|||...:|..||:|.      
  Rat   217 QWVDKHARP-------FSTIKPMYGMAA---TTGTASPRLCAATTSSPLATANLSPSNGRSRGKR 271

  Fly   413 PTSYPRAN 420
            |||.|..|
  Rat   272 PTSPPPEN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916
REX1_like 686..837 CDD:99848
Trex1NP_001020160.1 TREX1_2 14..211 CDD:99839 29/188 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.