DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14811 and CG14810

DIOPT Version :9

Sequence 1:NP_569942.2 Gene:CG14811 / 31132 FlyBaseID:FBgn0029590 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_569941.2 Gene:CG14810 / 31131 FlyBaseID:FBgn0029589 Length:202 Species:Drosophila melanogaster


Alignment Length:257 Identity:129/257 - (50%)
Similarity:140/257 - (54%) Gaps:79/257 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 METNIQASI-WNKRFESTMMSSSEQSFAKSNGTKKKTVTYSRFIRTERVADGPTNAVQKKTVFFS 68
            ||.|:.||| .|||||||||||...|||||||.||||.|:||||||:|.|.|.||.|:||||..|
  Fly     1 MEKNLPASISKNKRFESTMMSSPVPSFAKSNGMKKKTTTFSRFIRTDRAAGGLTNGVKKKTVSVS 65

  Fly    69 RFDRTARAEEDLTRQLASVSLKPKQPVASTSNEQFFASNLHYYPHLPQPTAVGHYQTYAEIKSLW 133
            ||.|..|..|||||:||.:||| ||.|                                      
  Fly    66 RFSRVHRVAEDLTRELAGMSLK-KQAV-------------------------------------- 91

  Fly   134 LKGHFSQACNPTSRSMQPPRRISITNEFPDDQPKPAPKRRYSLVRRNSINLPIGSNFAMPVLMEE 198
                            ||.||.|.|||||||.|||||.||.||||||||||||.|||.|.|||::
  Fly    92 ----------------QPRRRYSFTNEFPDDPPKPAPNRRCSLVRRNSINLPIESNFDMSVLMDD 140

  Fly   199 E-----------------------KEEDEVKDLNENSGSTKPATSTSKGAIPKQPKKFALTF 237
            :                       :|||||:|||..|||..||||||||||||.||.|..||
  Fly   141 DDEEEEDDEMMMAKEEDDEMMMAKEEEDEVQDLNMTSGSINPATSTSKGAIPKPPKNFGFTF 202



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461650
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019581
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.