DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adar and Zn72D

DIOPT Version :9

Sequence 1:NP_001368969.1 Gene:Adar / 31130 FlyBaseID:FBgn0026086 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001261924.1 Gene:Zn72D / 39764 FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster


Alignment Length:316 Identity:59/316 - (18%)
Similarity:106/316 - (33%) Gaps:100/316 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GYQRQQFYAASSYAGKRSRFFVKRRFTFPSLPGNPVSAPSDINMNGYNRKL-------------- 78
            ||....:.|||.|..::.:             |||...|:....|.|.||:              
  Fly   143 GYDTALYNAASMYVAQQHQ-------------GNPNQKPNGGANNWYQRKMGATIPGATAIRGMR 194

  Fly    79 ------PQKRGY-EMPKYSDPKKKMCKERIPQPKNT----------------------------- 107
                  ||:..| |:.|.|....:..:|.:...|:.                             
  Fly   195 PKAPPRPQQLHYCEVCKISCAGPQTYREHLEGQKHKKREASLKMSASANSATQNRGNNYHCELCD 259

  Fly   108 ---------VAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGRSKKVARIE--AAA 161
                     .|.:...:|..:.||..:.|                |.:.....||:.:|.  .||
  Fly   260 VTCTGTDAYAAHVRGAKHQKVVKLHQKLG----------------KPIPSEEPKKMGKINFVPAA 308

  Fly   162 TALRSFIQFKDGAVLSPLKPAGNLDFTSDEHL-ENDVSKSAITVDGQKKVPDKGPVMLLYEL--- 222
            .......:.:.||  :....||:||...|:.| ||..:...:..:..::|.|:...:|.:..   
  Fly   309 AGGAGVAKTEGGA--NESDAAGDLDDNLDDSLGENTDNIKPVGGEYIEEVKDEEGKILSFNCKLC 371

  Fly   223 ---FNDVNFECINIDGAQNNCRFKMTVTIN-EKKFDGTGPSKKTAKNAAAKAALAS 274
               |||.|.:.:::.|.::..::|..|..: ...|..|...::.|:..|.:|.::|
  Fly   372 DCKFNDPNAKEMHMKGRRHRLQYKRKVQPDLVVDFKPTPRQRRLAEARANRAMMSS 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdarNP_001368969.1 DSRM_STRBP_RED-like_rpt1 105..167 CDD:380694 12/101 (12%)
DSRM_SF 213..>259 CDD:412133 10/52 (19%)
ADEAMc 306..677 CDD:214718
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732 6/30 (20%)
C2H2 Zn finger 207..229 CDD:275371 4/21 (19%)
ZnF_U1 252..284 CDD:197732 3/31 (10%)
C2H2 Zn finger 255..277 CDD:275371 1/21 (5%)
ZnF_U1 368..396 CDD:197732 5/27 (19%)
C2H2 Zn finger 368..390 CDD:275371 5/21 (24%)
DZF 577..829 CDD:128842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.