DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adar and CG12493

DIOPT Version :9

Sequence 1:NP_001368969.1 Gene:Adar / 31130 FlyBaseID:FBgn0026086 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_647927.3 Gene:CG12493 / 38575 FlyBaseID:FBgn0035571 Length:296 Species:Drosophila melanogaster


Alignment Length:262 Identity:66/262 - (25%)
Similarity:103/262 - (39%) Gaps:59/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DINMNGYNRKLPQKRGYEMPKY--------SDPKKK-----------MCKERIPQP-------KN 106
            |.||......|....|..|.|.        ||||||           ..|:|:.:|       |:
  Fly    32 DCNMPDGESSLVITDGDSMSKIPDDAAMATSDPKKKKKKVKKLKRSQKAKDRLVRPLPKAVTSKD 96

  Fly   107 TVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGRSKKVARIEAAATALRSFIQFK 171
            .:.:|.||:..:|..::.:..  |......::.|:.:||..:|.|:..|...|...|||..:..|
  Fly    97 ALMVLKELKGVIIDNMQIKQD--HEGKNVANIVVNSKKYDAEGSSENSAGNAACEKALREILTTK 159

  Fly   172 DGAVLS-PLKPAG----------------------NLDFTSDEHLENDV-SKSAITVDGQ--KKV 210
            ..|:|: |...:|                      |.|......|.||| :|...:..||  |..
  Fly   160 MKALLAEPENSSGGDEDNILEKMTSYAVYKLAEKWNSDAIDVAALYNDVKNKKTSSSVGQLPKLW 224

  Fly   211 PDKGPVMLLYELFNDVNFECINIDGAQNNCRFKMTVTINEKKFDGTGPSKKTAKNAAAKAALASL 275
            .:..|.|:|.::.....|:.:...| :|...|.|.|:::..:|...||:||.|:...|    |.:
  Fly   225 KNMHPCMVLMQMRPQTTFKFLGSSG-ENRKVFSMGVSVDNCEFKADGPTKKDARRKVA----ALV 284

  Fly   276 CN 277
            ||
  Fly   285 CN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdarNP_001368969.1 DSRM_STRBP_RED-like_rpt1 105..167 CDD:380694 16/61 (26%)
DSRM_SF 213..>259 CDD:412133 11/45 (24%)
ADEAMc 306..677 CDD:214718
CG12493NP_647927.3 DSRM 229..289 CDD:214634 19/63 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467855
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10910
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.