DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adar and Ilf3

DIOPT Version :9

Sequence 1:NP_001368969.1 Gene:Adar / 31130 FlyBaseID:FBgn0026086 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_011240705.1 Gene:Ilf3 / 16201 MGIID:1339973 Length:916 Species:Mus musculus


Alignment Length:335 Identity:100/335 - (29%)
Similarity:144/335 - (42%) Gaps:63/335 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GRACYKSCHHAMRVARSSFGY----QRQQFYAASSYAGKRSRF-FVKRRFTFPSLPGNPVSAPSD 68
            |...|..|.   :.|..:.|:    ||:....::.:|.:.:.| .:.:......||......|.:
Mouse   306 GSGIYDPCE---KEATDAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGMDPLPSKMPKKPKN 367

  Fly    69 INMNGYNRKLPQKRGYEMPKYSDP-------------KKKMCKER----IPQPKNTVAMLNELRH 116
            .|...|..::|....|.:.....|             |||:.|:.    .||..|.:..||:|:.
Mouse   368 ENPVDYTVQIPPSTTYAITPMKRPMEEDGEEKSPSKKKKKIQKKEEKADPPQAMNALMRLNQLKP 432

  Fly   117 GLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGRSKKVARIEAAATAL-----------RSFIQF 170
            ||.|||.|||||||||:||:||||||..:...|.|||.|::..|...|           |...:.
Mouse   433 GLQYKLISQTGPVHAPIFTMSVEVDGSNFEASGPSKKTAKLHVAVKVLQDMGLPTGAEGRDSSKG 497

  Fly   171 KDGAVLSPLKPA-------------GNLDFTSDEHLENDVSKSAITVDGQKKVPDKGPVMLLYEL 222
            :|.|..|..|||             .:..|.||...|..   ..:|..|      |.|||.|.|.
Mouse   498 EDSAEESDGKPAIVAPPPVVEAVSNPSSVFPSDATTEQG---PILTKHG------KNPVMELNEK 553

  Fly   223 FNDVNFECINIDGAQNNCRFKMTVTINEKKFDGTGPSKKTAKNAAAKAALASLCNISYSPMVV-- 285
            ...:.:|.|:..|..::.||.|.|.::.:||.|.|.:||.||..||.|||..|  ...:|:.:  
Mouse   554 RRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKL--FPDTPLALEA 616

  Fly   286 -PQKNVPLPI 294
             .:|..|:|:
Mouse   617 NKKKRTPVPV 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdarNP_001368969.1 DSRM_STRBP_RED-like_rpt1 105..167 CDD:380694 34/72 (47%)
DSRM_SF 213..>259 CDD:412133 17/45 (38%)
ADEAMc 306..677 CDD:214718
Ilf3XP_011240705.1 DZF 106..360 CDD:128842 11/56 (20%)
DSRM_ILF3_rpt1 416..488 CDD:380739 35/71 (49%)
DSRM_ILF3_rpt2 538..609 CDD:380741 29/78 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10264
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.