DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scgdelta and SGCG

DIOPT Version :9

Sequence 1:NP_001162639.2 Gene:Scgdelta / 31129 FlyBaseID:FBgn0025391 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001365173.1 Gene:SGCG / 6445 HGNCID:10809 Length:309 Species:Homo sapiens


Alignment Length:271 Identity:104/271 - (38%)
Similarity:165/271 - (60%) Gaps:12/271 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LGLIGWRKKCLYTLLLLLMLLIITNLVLTLWILKVMEFSTEGMGQLKIVPGGIQLSGQAIIMDML 198
            :|:.||||:|||..:|||:::::.||.||:||||||.||..|||.|.:...|::|.|::..:..|
Human    44 IGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPL 108

  Fly   199 RASTIRSRHGQPISIESSRNFSINTRDPNGMIENHLFLGHDKFECLSAGFRINDTNGRSLFSVNR 263
            .|..|.||....:.::|::|.::|.|:..|.:...|.:|....|..:..|:||..:|:.||:|:.
Human   109 YAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDE 173

  Fly   264 DEVTIGAHALRIDGEGGAVFRESVQTPHVRAEPGRELRLESPTRQLEMTAAKDINLQSRAGGIEV 328
            .||.:|...||:.|..||:|..||:||.|||:|.::||||||||.|.|.|.:.:::|:.||.||.
Human   174 KEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKIEA 238

  Fly   329 VALEDVKFRALDGSLRLESSKILMPNLRTAQPPILGTAQSRDHMHRVFQLCACSNGKLFLAAPHS 393
            ::..|:.|.:.||.|.|::..:.:|.|      :.||.........::::|.|.:|||:|:.   
Human   239 LSQMDILFHSSDGMLVLDAETVCLPKL------VQGTWGPSGSSQSLYEICVCPDGKLYLSV--- 294

  Fly   394 ICAGDDSTVCR 404
              || .||.|:
Human   295 --AG-VSTTCQ 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScgdeltaNP_001162639.2 Sarcoglycan_1 160..393 CDD:282624 86/232 (37%)
SGCGNP_001365173.1 Sarcoglycan_1 43..296 CDD:398454 99/262 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144336
Domainoid 1 1.000 208 1.000 Domainoid score I2861
eggNOG 1 0.900 - - E1_KOG3950
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3641
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52294
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001824
OrthoInspector 1 1.000 - - otm40990
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12939
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3754
SonicParanoid 1 1.000 - - X1185
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.890

Return to query results.
Submit another query.