DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scgdelta and sgcd

DIOPT Version :9

Sequence 1:NP_001162639.2 Gene:Scgdelta / 31129 FlyBaseID:FBgn0025391 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001001816.2 Gene:sgcd / 324961 ZFINID:ZDB-GENE-030131-3684 Length:292 Species:Danio rerio


Alignment Length:268 Identity:112/268 - (41%)
Similarity:161/268 - (60%) Gaps:11/268 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LGLIGWRKKCLYTLLLLLMLLIITNLVLTLWILKVMEFSTEGMGQLKIVPGGIQLSGQAIIMDML 198
            :|:.||||:|||..:||||:||:.||.||:||||||.|:.:|||.|:|...|::|.|.:..:..|
Zfish    27 VGIYGWRKRCLYFFVLLLMILIVVNLALTIWILKVMNFTIDGMGHLRITERGLKLEGDSEFLQPL 91

  Fly   199 RASTIRSRHGQPISIESSRNFSINTRDPNGMIENHLFLGHDKFECLSAGFRINDTNGRSLFSVNR 263
            .|..|:||.|.|:.::||:|.|:|..:....:.:.|..|............:..::|:.|||.:.
Zfish    92 YAKEIQSRPGSPLFLQSSKNVSVNILNEKKQLVSQLVAGSHGVHARGKMLEVKSSSGKLLFSADD 156

  Fly   264 DEVTIGAHALRIDGEGGAVFRESVQTPHVRAEPGRELRLESPTRQLEMTAAKDINLQSRAGGIEV 328
            .||.:||..||:.|..||||..||:||||||||.:|||||||||.|.|.|.|.:.:::.||..:.
Zfish   157 HEVVVGAERLRVMGAEGAVFSNSVETPHVRAEPFKELRLESPTRSLYMEAPKGVKIEADAGDFQA 221

  Fly   329 VALEDVKFRALDGSLRLESSKILMPNLRTAQPPILGTAQSRDHMHRVFQLCACSNGKLFLAAPHS 393
            ....|::..:.||.:.|::|||.:|.|...:....|..|:      ||::|.|.||||||:.   
Zfish   222 TCRSDLRLESKDGEISLDASKIKLPRLPEGKASTSGPRQT------VFEVCVCPNGKLFLSQ--- 277

  Fly   394 ICAGDDST 401
              ||..||
Zfish   278 --AGTGST 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScgdeltaNP_001162639.2 Sarcoglycan_1 160..393 CDD:282624 92/232 (40%)
sgcdNP_001001816.2 Sarcoglycan_1 26..279 CDD:309778 108/262 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577409
Domainoid 1 1.000 215 1.000 Domainoid score I2655
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H285
Inparanoid 1 1.050 215 1.000 Inparanoid score I3593
OMA 1 1.010 - - QHG52294
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001824
OrthoInspector 1 1.000 - - otm25701
orthoMCL 1 0.900 - - OOG6_106318
Panther 1 1.100 - - LDO PTHR12939
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.