DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scgdelta and Sgcd

DIOPT Version :9

Sequence 1:NP_001162639.2 Gene:Scgdelta / 31129 FlyBaseID:FBgn0025391 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_036021.1 Gene:Sgcd / 24052 MGIID:1346525 Length:289 Species:Mus musculus


Alignment Length:276 Identity:108/276 - (39%)
Similarity:164/276 - (59%) Gaps:17/276 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LGLIGWRKKCLYTLLLLLMLLIITNLVLTLWILKVMEFSTEGMGQLKIVPGGIQLSGQAIIMDML 198
            :|:.||||:|||..:||||:||:.||.:|:||||||.|:.:|||.|:|...|::|.|.:..:..|
Mouse    24 VGIYGWRKRCLYFFVLLLMILILVNLAMTIWILKVMNFTIDGMGNLRITEKGLKLEGDSEFLQPL 88

  Fly   199 RASTIRSRHGQPISIESSRNFSINTRDPNGMIENHLFLGHDKFECLSAGFRINDTNGRSLFSVNR 263
            .|..|:||.|..:..:|:||.::|..:....:...|..|....|.....|.:...:|:.|||.:.
Mouse    89 YAKEIKSRPGNALYFKSARNVTVNILNDQTKVLTQLVTGPKAVEAYGKRFEVKTVSGKLLFSADD 153

  Fly   264 DEVTIGAHALRIDGEGGAVFRESVQTPHVRAEPGRELRLESPTRQLEMTAAKDINLQSRAGGIEV 328
            .||.:||..||:.|..|.||.:|::||:|||:|.:|||||||||.|.|.|.|.:.:.:.||.:|.
Mouse   154 SEVVVGAERLRVLGAEGTVFPKSIETPNVRADPFKELRLESPTRSLVMEAPKGVEINAEAGNMEA 218

  Fly   329 VALEDVKFRALDGSLRLESSKILMPNLRTAQPPILGTAQSRDHMHRVFQLCACSNGKLFLAAPHS 393
            :...:::..:.||.::|:::||.:|.|........||.|      :||::|.|:||:|||:.   
Mouse   219 ICRSELRLESKDGEIKLDAAKIKLPRLPRGSYTPTGTRQ------KVFEVCVCANGRLFLSQ--- 274

  Fly   394 ICAGDDST------VC 403
              ||..||      ||
Mouse   275 --AGTGSTCQINTSVC 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScgdeltaNP_001162639.2 Sarcoglycan_1 160..393 CDD:282624 86/232 (37%)
SgcdNP_036021.1 Sarcoglycan_1 23..276 CDD:398454 102/262 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834475
Domainoid 1 1.000 208 1.000 Domainoid score I2851
eggNOG 1 0.900 - - E1_KOG3950
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H285
Inparanoid 1 1.050 208 1.000 Inparanoid score I3678
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52294
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001824
OrthoInspector 1 1.000 - - otm43061
orthoMCL 1 0.900 - - OOG6_106318
Panther 1 1.100 - - LDO PTHR12939
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3754
SonicParanoid 1 1.000 - - X1185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.