DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scgdelta and SGCZ

DIOPT Version :9

Sequence 1:NP_001162639.2 Gene:Scgdelta / 31129 FlyBaseID:FBgn0025391 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_631906.2 Gene:SGCZ / 137868 HGNCID:14075 Length:312 Species:Homo sapiens


Alignment Length:278 Identity:107/278 - (38%)
Similarity:162/278 - (58%) Gaps:15/278 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LGLIGWRKKCLYTLLLLLMLLIITNLVLTLWILKVMEFSTEGMGQLKIVPGGIQLSGQAIIMDML 198
            :|:.||||:|||..:|||::.:|.||.:|:||||||.|:.:|||.|::...||:|.|.:..:..|
Human    39 VGIYGWRKRCLYFFVLLLLVTMIVNLAMTIWILKVMNFTVDGMGNLRVTKKGIRLEGISEFLLPL 103

  Fly   199 RASTIRSRHGQPISIESSRNFSINTRDPNGMIENHLFLGHDKFECLSAGFRIN-DTNGRSLFSVN 262
            ....|.||...|:.::|.||.::|.|:..|.:...|.:|.|..|.....|.:. ..:||.|||.:
Human   104 YVKEIHSRKDSPLVLQSDRNVTVNARNHMGQLTGQLTIGADAVEAQCKRFEVRASEDGRVLFSAD 168

  Fly   263 RDEVTIGAHALRIDGEGGAVFRESVQTPHVRAEPGRELRLESPTRQLEMTAAKDINLQSRAGGIE 327
            .||:||||..|::.|..||||..||:|||:||||.::||||||||.|.|.|.:.:.:.:.||..:
Human   169 EDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDLRLESPTRSLIMEAPRGVQVSAAAGDFK 233

  Fly   328 VVALEDVKFRALDGSLRLESSKILMPNLRT-----AQPPILGTAQSRDHMHRVFQLCACSNGKLF 387
            ....:::..::.:|.:.|.:..|.:.||.|     :.|....:.|:      |::||.|.||||:
Human   234 ATCRKELHLQSTEGEIFLNAETIKLGNLPTGSFSSSSPSSSSSRQT------VYELCVCPNGKLY 292

  Fly   388 L--AAPHSICAGDDSTVC 403
            |  |...|.|. ..|.:|
Human   293 LSPAGVGSTCQ-SSSNIC 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScgdeltaNP_001162639.2 Sarcoglycan_1 160..393 CDD:282624 89/240 (37%)
SGCZNP_631906.2 Sarcoglycan_1 38..297 CDD:398454 102/263 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144334
Domainoid 1 1.000 208 1.000 Domainoid score I2861
eggNOG 1 0.900 - - E1_KOG3950
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3641
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52294
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001824
OrthoInspector 1 1.000 - - otm40990
orthoMCL 1 0.900 - - OOG6_106318
Panther 1 1.100 - - O PTHR12939
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3754
SonicParanoid 1 1.000 - - X1185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.