DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scgdelta and sgcz

DIOPT Version :9

Sequence 1:NP_001162639.2 Gene:Scgdelta / 31129 FlyBaseID:FBgn0025391 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_017951080.2 Gene:sgcz / 100486888 XenbaseID:XB-GENE-985523 Length:298 Species:Xenopus tropicalis


Alignment Length:278 Identity:103/278 - (37%)
Similarity:163/278 - (58%) Gaps:15/278 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LGLIGWRKKCLYTLLLLLMLLIITNLVLTLWILKVMEFSTEGMGQLKIVPGGIQLSGQAIIMDML 198
            :|:.||||:|||..:|||::.:|.||.:|:||||||.|:.:|||.|:|...|::|.|.:..:..|
 Frog    25 VGIYGWRKRCLYFFVLLLLVTMIVNLAMTIWILKVMNFTVDGMGNLRITKKGVRLEGVSEFLLPL 89

  Fly   199 RASTIRSRHGQPISIESSRNFSINTRDPNGMIENHLFLGHDKFECLSAGFRI-NDTNGRSLFSVN 262
            ....|.||...|:..:|.||.::|.|:.||.:...:.:|.|..|.....|.: :..:.|.||..:
 Frog    90 YVKEIHSRKDSPVVFQSDRNITLNARNENGQLTGQMTVGADAVEAQCKRFEVKSHEDERILFMAD 154

  Fly   263 RDEVTIGAHALRIDGEGGAVFRESVQTPHVRAEPGRELRLESPTRQLEMTAAKDINLQSRAGGIE 327
            .:|:.|||..||:.|..|::|..||:|||:||.|.::||||||||.|.|.|.|.:::.:.||..:
 Frog   155 EEEIVIGADRLRVTGTEGSIFEHSVETPHIRAGPSQDLRLESPTRSLTMEAPKGVHISAVAGEFK 219

  Fly   328 VVALEDVKFRALDGSLRLESSKILMPNL-----RTAQPPILGTAQSRDHMHRVFQLCACSNGKLF 387
            ....::::.::.||.:.|.:..|.:.||     .::.|..:|..|:      |::||.|.||||:
 Frog   220 ASCRKELQLQSTDGEIFLNADNIRLGNLPHGSYSSSTPNAVGPRQT------VYELCICPNGKLY 278

  Fly   388 L--AAPHSICAGDDSTVC 403
            |  |...|.|. .:|.:|
 Frog   279 LSPAGASSTCQ-LNSNIC 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScgdeltaNP_001162639.2 Sarcoglycan_1 160..393 CDD:282624 85/240 (35%)
sgczXP_017951080.2 Sarcoglycan_1 24..284 CDD:398454 99/264 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I2743
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 211 1.000 Inparanoid score I3566
OMA 1 1.010 - - QHG52294
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001824
OrthoInspector 1 1.000 - - otm48188
Panther 1 1.100 - - O PTHR12939
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3754
SonicParanoid 1 1.000 - - X1185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.