DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scgdelta and sgcz

DIOPT Version :9

Sequence 1:NP_001162639.2 Gene:Scgdelta / 31129 FlyBaseID:FBgn0025391 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_017211482.1 Gene:sgcz / 100334126 -ID:- Length:300 Species:Danio rerio


Alignment Length:274 Identity:103/274 - (37%)
Similarity:161/274 - (58%) Gaps:6/274 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LGLIGWRKKCLYTLLLLLMLLIITNLVLTLWILKVMEFSTEGMGQLKIVPGGIQLSGQAIIMDML 198
            :|:.||||:|||..:|||::.:|.||.||:||||||.|:.:|||.|::...||:|.|.:..:..|
Zfish    26 VGIYGWRKRCLYFFILLLLVTMIVNLALTIWILKVMNFTVDGMGNLRVTKEGIRLEGVSEFLLPL 90

  Fly   199 RASTIRSRHGQPISIESSRNFSINTRDPNGMIENHLFLGHDKFECLSAGFRINDTNG-RSLFSVN 262
            ....|.||...|:.::|.||.::|.|:..|.:...|.:|.:..|.....|.:..::| |.|||.:
Zfish    91 YVKEINSRRDSPLVLQSDRNVTVNARNNLGQLTGQLTVGSEMVEAQCQRFEVRSSDGERVLFSAD 155

  Fly   263 RDEVTIGAHALRIDGEGGAVFRESVQTPHVRAEPGRELRLESPTRQLEMTAAKDINLQSRAGGIE 327
            .:|::||...||:.|..|.||..||:||||||||.::|:||||||.|.:.|.|.:.:.:..|..:
Zfish   156 EEEISIGTDKLRVTGNEGVVFSHSVETPHVRAEPFQDLKLESPTRTLTLEAPKGVEVNAGVGEFK 220

  Fly   328 VVALEDVKFRALDGSLRLESSKILMPNL-RTAQPPILGTAQSRDHMHRVFQLCACSNGKLFL--A 389
            ....:|:...:.:|.:.|.::.|.:.|| ..:..|:||...:.. ...|:::|.|.:|||:|  |
Zfish   221 ASCRKDLTLESSEGEIYLNANSIRLGNLPHGSVDPLLGPGTTYP-KQTVYEVCVCPSGKLYLSPA 284

  Fly   390 APHSICAGDDSTVC 403
            ...|.|...:| ||
Zfish   285 ESSSTCQTTNS-VC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScgdeltaNP_001162639.2 Sarcoglycan_1 160..393 CDD:282624 84/236 (36%)
sgczXP_017211482.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577408
Domainoid 1 1.000 215 1.000 Domainoid score I2655
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3593
OMA 1 1.010 - - QHG52294
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001824
OrthoInspector 1 1.000 - - otm25701
orthoMCL 1 0.900 - - OOG6_106318
Panther 1 1.100 - - O PTHR12939
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1185
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.