DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG17234

DIOPT Version :10

Sequence 1:NP_569939.2 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:49 Identity:11/49 - (22%)
Similarity:22/49 - (44%) Gaps:9/49 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   654 LEKDTPLRPAQLPPTH-----RKSALDQTI----PASPNSPDSINNFHP 693
            |:|..|.:...:|..:     ::|.:.:|:    |.||.|....:.:.|
  Fly    20 LQKFKPTKTKSIPQENKSKPSKQSTVGKTVTVRLPRSPQSEKVFDTYAP 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_569939.2 Tryp_SPc 60..281 CDD:238113
CG17234NP_722785.1 Tryp_SPc 27..243 CDD:238113 8/42 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.