DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG17234

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:283 Identity:77/283 - (27%)
Similarity:123/283 - (43%) Gaps:58/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFF 73
            ::||:::...|     |||::.           ::..:.|| .|...:.|.:.|||      ::|
  Fly     6 FLLLLALDFLS-----AGQVNR-----------WEQRIIGG-EPIGIEQVPWQVSL------QYF 47

  Fly    74 GDNHFCAGTIFSERAILTAAHCMFSNR-RKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHPK 137
            || |.|.|:|:||..|:|||||.|... .:|..:...|.||:   .|..|...:::...|:.|.:
  Fly    48 GD-HVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGS---ALTDSNGTLVDVAALIIHEE 108

  Fly   138 YKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAINGDM 202
            |....:.. ||.::.|...|.....|..|||....|...:...:.|||.        ...:|...
  Fly   109 YAFDLNIN-DIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWGV--------SYILNDST 164

  Fly   203 QILP-----------DTFCEKLLGWSNAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFG 256
            .:.|           ..|..:|.   :..:|||.....:   :|.|||||||:.:..:.|:||:|
  Fly   165 NLYPTHLQGLALHIKSIFSCRLF---DPSLLCAGTYGRT---ACHGDSGGPLVVNKQLVGVVSWG 223

  Fly   257 -MGCGEPDSAGIYTDVYHFRDWI 278
             .||   .|:..:..|.:||:||
  Fly   224 RKGC---VSSAFFVSVPYFREWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 67/232 (29%)
Tryp_SPc 60..278 CDD:214473 65/230 (28%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 69/245 (28%)
Tryp_SPc 27..243 CDD:238113 69/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.