DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG17239

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:220 Identity:70/220 - (31%)
Similarity:106/220 - (48%) Gaps:29/220 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LRMGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTT---- 124
            ||:|:        ..|...|:||..::|||||:.....:.    |.|..|       ||.|    
  Fly    42 LRLGR--------FHCGAAIYSEDIVITAAHCLTDRETEF----LSVRVG-------SSFTFFGG 87

  Fly   125 QIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWGTVIQ 189
            |::....:|.|.:|.:..|.  ||.::.|::.|.||.||:.|||.:..|.:|:|.::.|||.:..
  Fly    88 QVVRVSSVLLHEEYDQSWSN--DIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAIGF 150

  Fly   190 FGPLPDEAINGDMQILPDTFCEKLLGWS-NAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIV 253
            ....|...::..:.|:....|.:..|.. ...|:||   .....|:|.|||||||:..|.:.|||
  Fly   151 KKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICA---AAPGKDACSGDSGGPLVSGNKLVGIV 212

  Fly   254 SFGMGCGEPDSAGIYTDVYHFRDWI 278
            |||..|..|:..|:|.:|...:.||
  Fly   213 SFGKECAHPEYPGVYANVAELKPWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 70/220 (32%)
Tryp_SPc 60..278 CDD:214473 68/218 (31%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 68/218 (31%)
Tryp_SPc 24..237 CDD:238113 68/218 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.