DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and F12

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_067464.2 Gene:F12 / 58992 MGIID:1891012 Length:597 Species:Mus musculus


Alignment Length:312 Identity:83/312 - (26%)
Similarity:134/312 - (42%) Gaps:62/312 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGG----YRPDTNDLVKYT---VSLRMGKP 69
            |:...:...|.|||..|..||:...|..:......|.|    :|...:..::..   |:|....|
Mouse   303 LVVPESQEESPSQAPSLSHAPNDSTDHQTSLSKTNTMGCGQRFRKGLSSFMRVVGGLVALPGSHP 367

  Fly    70 --KKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEEL 132
              ...:..|:||||::.:...:||||||:   :.:...::|.||.|..|........|.:.....
Mouse   368 YIAALYWGNNFCAGSLIAPCWVLTAAHCL---QNRPAPEELTVVLGQDRHNQSCEWCQTLAVRSY 429

  Fly   133 LPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKV--PVAGAP------CSIVGWG---- 185
            ..|..: ...:.::|:.|:.|:...:...|:.. |....|  |...||      |.:.|||    
Mouse   430 RLHEGF-SSITYQHDLALLRLQESKTNSCAILS-PHVQPVCLPSGAAPPSETVLCEVAGWGHQFE 492

  Fly   186 ------TVIQFGPLP--------DEAINGDMQILPDTFCEKLLGWSNAGMLCANDKHDSDVDSCQ 236
                  |.:|...:|        :..::|| .|||             |||||... :...|:||
Mouse   493 GAEEYSTFLQEAQVPFIALDRCSNSNVHGD-AILP-------------GMLCAGFL-EGGTDACQ 542

  Fly   237 GDSGGPLICDN-------MVTGIVSFGMGCGEPDSAGIYTDVYHFRDWITEN 281
            |||||||:|:.       .:.|::|:|.|||:.:..|:||||.::..||.::
Mouse   543 GDSGGPLVCEEGTAEHQLTLRGVISWGSGCGDRNKPGVYTDVANYLAWIQKH 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 71/258 (28%)
Tryp_SPc 60..278 CDD:214473 69/255 (27%)
F12NP_067464.2 FN2 41..88 CDD:238019
EGF_CA 96..131 CDD:238011
FN1 133..173 CDD:238018
EGF 178..206 CDD:278437
KR 217..295 CDD:294073
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..338 8/31 (26%)
Tryp_SPc 354..591 CDD:214473 69/256 (27%)
Tryp_SPc 355..594 CDD:238113 71/258 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.