DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and KLK10

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:268 Identity:71/268 - (26%)
Similarity:114/268 - (42%) Gaps:56/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFGDNHFCAGTIFSERAILT 91
            :.:.:|..|..:|                    :.|||       |.|.:..|||.:..:..:||
Human    46 EAYGSPCARGSQP--------------------WQVSL-------FNGLSFHCAGVLVDQSWVLT 83

  Fly    92 AAHCMFSNRRKLKAK----KLMVVAGTPRRLLKSSTTQIIEAEELLPHPKYKKG-------KSQK 145
            ||||   ..:.|.|:    .|:::.|   ..|:.:|..::       ||||.:|       ::.:
Human    84 AAHC---GNKPLWARVGDDHLLLLQG---EQLRRTTRSVV-------HPKYHQGSGPILPRRTDE 135

  Fly   146 YDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAIN-GDMQILPDTF 209
            :|:.|:.|...:.||..|..:.|..:....|..|.:.||||........::.:. ..:.||....
Human   136 HDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKE 200

  Fly   210 CEKLL-GWSNAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGM-GCGEPDSAGIYTDVY 272
            ||... |.....|:||.  .|...|.||.||||||:||..:.||:|:|: .||......:||.:.
Human   201 CEVFYPGVVTNNMICAG--LDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQIC 263

  Fly   273 HFRDWITE 280
            .:..||.:
Human   264 KYMSWINK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 68/235 (29%)
Tryp_SPc 60..278 CDD:214473 66/231 (29%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 71/265 (27%)
Tryp_SPc 49..269 CDD:214473 69/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.