DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and Prss53

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:287 Identity:67/287 - (23%)
Similarity:102/287 - (35%) Gaps:94/287 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEEL----LPHPK 137
            |.|:|::.::..:|||||| |......:.....||.|:.::...|.     .|||:    |..||
  Rat    60 HICSGSLVADTWVLTAAHC-FEKMATAELSSWSVVLGSLKQEGLSP-----GAEEVGVAALQLPK 118

  Fly   138 YKKGKSQKYDIGLI-----LLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGW------------- 184
            .....||..|:.|:     ::...|.|.......|.       ||.|...||             
  Rat   119 AYNHYSQGSDLALLQLTHPIVHTTLCLPQPTHHFPF-------GASCWATGWDQNTSDGKYCPRH 176

  Fly   185 -------GTVI---------------QFGPLPDEAINGDMQI----LPDTFC------EKLL-GW 216
                   |:|:               ...|||......::::    .|...|      ::|| ..
  Rat   177 KSRESQTGSVLTVLALCSHCVSELDSTLSPLPVSRTLRNLRLRLISRPTCNCLYNRLHQRLLANP 241

  Fly   217 SNAGMLCANDKHDSDVDSCQGDSGGPLICDN-----MVTGIVSFGMGCGEPDSAGIYTDVYHFRD 276
            :.:||||...:.... ..||||||||::|..     :..||:||...|.:.|:..:.||:.....
  Rat   242 ARSGMLCGGAQPGVQ-GPCQGDSGGPVMCREPDGHWVQVGIISFTSNCAQEDTPVLLTDMAAHSS 305

  Fly   277 WI--------------------TENSC 283
            |:                    .||||
  Rat   306 WLQAHVDRAAFLVQDPGVVKMSDENSC 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 63/283 (22%)
Tryp_SPc 60..278 CDD:214473 62/260 (24%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 63/263 (24%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.