DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and Prss36

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:284 Identity:83/284 - (29%)
Similarity:132/284 - (46%) Gaps:50/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SAPSQRQDRPSDFQFLVTGGYRPDTNDLV-----------KYTVSLRMGKPKKFFGDNHFCAGTI 83
            ||.|..|   .:|:.|..|  ||:.:..:           .:.|||.       .|..|.|.|::
  Rat    36 SAVSPTQ---GEFEDLDCG--RPEPSSRIVGGSDAHPGTWPWQVSLH-------HGGGHICGGSL 88

  Fly    84 FSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRR--LLKSSTTQIIEAEELLP--HPKYKKGKSQ 144
            .:...:|:||||..:|.....|.:..|:.|...:  .|:.:..:.: |..|:|  :.:.:.|.  
  Rat    89 IAPSWVLSAAHCFVTNGTLEPADEWSVLLGVHSQDGPLEGAHMRSV-ATILVPDNYSRVELGA-- 150

  Fly   145 KYDIGLILLEADLSLGDAVAKI--PLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAI--NGDMQIL 205
              |:.|:.|.:...||.:|..:  |..:.:...|..|...|||.|.:..|||...:  ..::::|
  Rat   151 --DLALLRLASPAKLGPSVKPVCLPRASHLFAHGTACWATGWGDVQESDPLPVPWVLQEVELKLL 213

  Fly   206 PDTFCEKLL---GWSN------AGMLCANDKHDSDVDSCQGDSGGPLICDN----MVTGIVSFGM 257
            .:|.|:.|.   |..|      .|||||. ..:...|:|||||||||:|::    .:.||.|||.
  Rat   214 GETACQCLYSRPGPFNLTLQLLPGMLCAG-YPEGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGF 277

  Fly   258 GCGEPDSAGIYTDVYHFRDWITEN 281
            |||..:..|::|.|.|:..||.|:
  Rat   278 GCGRRNRPGVFTAVAHYESWIREH 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 73/241 (30%)
Tryp_SPc 60..278 CDD:214473 71/238 (30%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 73/254 (29%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.