DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG34130

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:295 Identity:62/295 - (21%)
Similarity:114/295 - (38%) Gaps:61/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVVYILLISVSANSNS--ESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGK 68
            |.:.:||..|.|..:|  .|.|..||..|..|....:..: ..:||:      .|.:.:.:    
  Fly     8 FSIALLLTEVGAAHSSWWNSSASYLHGRPPVRTLNKNGIR-RTSGGH------AVPWLLRI---- 61

  Fly    69 PKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELL 133
               ..|....|..:..|....||:|:||.|:|.::::..:.:|:...|                 
  Fly    62 ---VDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVELVSSDSR----------------- 106

  Fly   134 PHPKYKKGKSQKYD-----IGLILLEADLSLGDA---VAKIPLYNK--------VPVAGAPCSIV 182
                 :..:...:|     |..|::..|......   ||.|.|.|:        |.:...|.|..
  Fly   107 -----QDNQLDSHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLRGNRNNYVTLCTNPLSSY 166

  Fly   183 GWGTVIQFGPLPDEAI-NGDMQILPDTFCEKLLG--WSNAGMLCAND-KHDSDVDSCQGDSGGPL 243
            ...:|:.:|..|.|.: ..::::|....|:...|  .....:.||.: |..:|   |...:|.|:
  Fly   167 KSLSVVSYGAGPAENVRTEEIEVLNRMICDSAYGNFLLRETVACAKEFKRSAD---CMFSAGCPV 228

  Fly   244 ICDNMVTGIVSFGMGCGEPDSAGIYTDVYHFRDWI 278
            ...:.:.|||::...|...:..||:||::..:.:|
  Fly   229 TAGDQLCGIVAWSPACKRSNLPGIFTDIHQVKRFI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 47/239 (20%)
Tryp_SPc 60..278 CDD:214473 46/237 (19%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 47/247 (19%)
Tryp_SPc 53..256 CDD:304450 46/240 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.