DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG7829

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:263 Identity:80/263 - (30%)
Similarity:116/263 - (44%) Gaps:45/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFGDNHFCAGTIFSERAILTA 92
            |.|.|..|          :.||:..|..: :.|.||:::      :|.:| |.|:|.:...||||
  Fly    20 LESRPDPR----------IVGGFPADIAN-IPYIVSIQL------YGIHH-CGGSIINNHTILTA 66

  Fly    93 AHCMFSNRRKLKAKKLMVVAGTPRRLLK---SSTT------QIIEAEELLPHPKYKKGKSQKYDI 148
            .||:               .|.|.||||   ..|:      ::....:|..|..:.. |:..|||
  Fly    67 GHCL---------------NGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNP-KTMDYDI 115

  Fly   149 GLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAINGDMQILPDTFCEKL 213
            |:|.|..:|:|...|..||:..:....|...:|.|||.....||..|......:.|:..|.|..|
  Fly   116 GIIRLTKNLTLSRKVKAIPINPERVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNL 180

  Fly   214 LGWS-NAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDSAGIYTDVYHFRDW 277
            ||.: ...||||. ......|:||.||||||.....:.||||:|:||...|..|:|:.:.....|
  Fly   181 LGKTVTDRMLCAG-YLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPW 244

  Fly   278 ITE 280
            :.:
  Fly   245 LDQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 73/231 (32%)
Tryp_SPc 60..278 CDD:214473 72/227 (32%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 76/251 (30%)
Tryp_SPc 28..248 CDD:238113 76/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.