DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG16749

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:285 Identity:68/285 - (23%)
Similarity:112/285 - (39%) Gaps:70/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVK---YTVSLRMGKPKKFFGDNHFCAGTIFSE 86
            ||..|.||...:        :|.|     |:..|:   :.:|:|..      ..:|.|.|:|.|:
  Fly    18 AGISHGAPQMGR--------VVNG-----TDSSVEKYPFVISMRGS------SGSHSCGGSIISK 63

  Fly    87 RAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLI 151
            :.::|||||....    ||..|.|..|..:  :.::...::..::::.|..|....:...||.|:
  Fly    64 QFVMTAAHCTDGR----KASDLSVQYGVTK--INATGPNVVRVKKIIQHEDYNPYNNYANDISLL 122

  Fly   152 LLEADLSLGDAVAKIPLYNKVPV---------AGAPCSIVGWGTVIQFGPLPDEAINGDMQILPD 207
            |:|..... |.|...|:  |:|.         ||....::|||.....|.:.......::::..|
  Fly   123 LVEEPFEF-DGVTVAPV--KLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSD 184

  Fly   208 TFCEKLLGWSNAGMLCANDKHDSDVD---------------SCQGDSGGPLICDNMVTGIVSFGM 257
            ..|              .::|....|               .|.||||||||.:....||||:.:
  Fly   185 EEC--------------TERHGGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSI 235

  Fly   258 -GCGEPDSAGIYTDVYHFRDWITEN 281
             .|......|:|..|..:.|||.::
  Fly   236 KPCTVAPYPGVYCKVSQYVDWIKKS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 59/245 (24%)
Tryp_SPc 60..278 CDD:214473 57/242 (24%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 61/269 (23%)
Tryp_SPc 30..259 CDD:238113 63/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.