DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG12951

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:254 Identity:63/254 - (24%)
Similarity:104/254 - (40%) Gaps:56/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NDLVKY--TVSLRMGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRR 117
            :.::||  .||||.      :..:|.|.|:|.|:..::|||||  :|.|  .|..|.:..|... 
  Fly    36 SSVLKYPFVVSLRS------YDGSHSCGGSIISKHFVMTAAHC--TNGR--PADTLSIQFGVTN- 89

  Fly   118 LLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPV-------- 174
             :.:....::..::::.|..:...:....||.|:::|..... |.|:..|:  ::|.        
  Fly    90 -ISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEF-DGVSVAPV--ELPALAFAVPQS 150

  Fly   175 -AGAPCSIVGWGTVIQFGPLPDEAINGDMQILPDTFCEKLLGWSNAGMLCANDKHDSDVD----- 233
             ||....::|||....:|.:.|......::|..|..|              ..:|:...|     
  Fly   151 DAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEEC--------------TSRHNGQTDPKYHI 201

  Fly   234 ----------SCQGDSGGPLICDNMVTGIVSFGM-GCGEPDSAGIYTDVYHFRDWITEN 281
                      .|.||||||||.:....||||:.: .|......|:|..|..:.|||..|
  Fly   202 CGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 61/247 (25%)
Tryp_SPc 60..278 CDD:214473 59/244 (24%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 60/249 (24%)
Tryp_SPc 30..260 CDD:238113 62/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.