DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG10587

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:277 Identity:68/277 - (24%)
Similarity:112/277 - (40%) Gaps:67/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRK 102
            ||. ||..|.||.......|..|.::||       :..|..|.||:..:..:||||||...   :
  Fly    39 RPG-FQTRVVGGDVTTNAQLGGYLIALR-------YEMNFVCGGTLLHDLIVLTAAHCFLG---R 92

  Fly   103 LKAKKLMVVAGTPR---RLLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVA 164
            :|....:.|.|..:   |.::....::|::.|.       :......|:.::.|:..:. |.::.
  Fly    93 VKISDWLAVGGASKLNDRGIQRQVKEVIKSAEF-------REDDMNMDVAILRLKKPMK-GKSLG 149

  Fly   165 KIPLYNKVPVAGAPCSIVGWGTV--IQFGP---------------------LPDE-------AIN 199
            ::.|..|..:.|....:.|||..  .:|||                     ||.:       .:.
  Fly   150 QLILCKKQLMPGTELRVSGWGLTENSEFGPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLF 214

  Fly   200 GDMQILPDTFCEKLLGWSNAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDS 264
            ..:.:....||..:||               ..|:|..||||||:..|.|.||||||:||.....
  Fly   215 LKVHLTDSMFCAGVLG---------------KKDACTFDSGGPLVYKNQVCGIVSFGIGCASKRY 264

  Fly   265 AGIYTDVYHFRDWITEN 281
            .|:|||:.:.:.:|.::
  Fly   265 YGVYTDIMYVKPFIEQS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 60/253 (24%)
Tryp_SPc 60..278 CDD:214473 59/250 (24%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 63/265 (24%)
Tryp_SPc 46..280 CDD:238113 64/266 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.