DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG11037

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:263 Identity:65/263 - (24%)
Similarity:104/263 - (39%) Gaps:53/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKL 103
            ||..:..|.||:......|..|..:|       .:.|:..|.||:.:|..:||||||...   ::
  Fly    55 PSPHETRVIGGHVTTNAKLGGYLTAL-------LYEDDFVCGGTLLNENIVLTAAHCFLG---RM 109

  Fly   104 KAKKLMVVAGTP---RRLLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAK 165
            ||.:.:|.||..   ::.::......|.:|:.       :......|:.::||:..|...: :..
  Fly   110 KASEWIVAAGISNLNQKGIRRHVKDFILSEQF-------REDDMNMDVAVVLLKTPLKAKN-IGT 166

  Fly   166 IPLYNKVPVAGAPCSIVGWGTVIQFGPLPDE-----------------AINGDMQILPDTFCEKL 213
            :.|.:.....|....:.|||.....|..|..                 |.....:|.....|..:
  Fly   167 LSLCSVSLKPGVELVVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMICAAV 231

  Fly   214 LGWSNAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDSAGIYTDVYHFRDWI 278
            ||..               |:|..||||||:....|.||||||:||......|:||||.:.:.:|
  Fly   232 LGRK---------------DACTFDSGGPLVFKKQVCGIVSFGIGCASNRYPGVYTDVMYVKPFI 281

  Fly   279 TEN 281
            .::
  Fly   282 EKS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 59/240 (25%)
Tryp_SPc 60..278 CDD:214473 58/237 (24%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 62/252 (25%)
Tryp_SPc 62..283 CDD:238113 63/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455660
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.